StarFunc result for job id Q9ULY5

User Input

>input (219 residues)
MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLP
ENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS
QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCA
TMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULY5	1.000	1.000	5.767E-42	219	1.000	1.000	Q9ULY5.pdb.gz	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
2	AFDB:Q9R0Q8	0.701	0.717	1.093E-30	214	0.653	0.668	Q9R0Q8.pdb.gz	CLC4E_MOUSE C-type lectin domain family 4 member E OS=Mus musculus OX=10090 GN=Clec4e PE=1 SV=1
3	AFDB:Q67EQ1	0.692	0.704	3.609E-29	215	0.667	0.679	Q67EQ1.pdb.gz	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
4	AFDB:Q9Z2H6	0.619	0.619	2.761E-19	219	0.361	0.361	Q9Z2H6.pdb.gz	CLC4D_MOUSE C-type lectin domain family 4 member D OS=Mus musculus OX=10090 GN=Clec4d PE=1 SV=1
5	AFDB:Q8WXI8	0.674	0.685	3.096E-19	215	0.361	0.367	Q8WXI8.pdb.gz	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
6	AFDB:Q9JKF4	0.638	0.667	3.472E-19	209	0.356	0.373	Q9JKF4.pdb.gz	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
7	AFDB:Q69FH1	0.623	0.625	1.298E-18	218	0.356	0.358	Q69FH1.pdb.gz	CLC4D_RAT C-type lectin domain family 4 member D OS=Rattus norvegicus OX=10116 GN=Clec4d PE=1 SV=1
8	AFDB:Q8WTT0	0.635	0.652	3.642E-18	213	0.356	0.366	Q8WTT0.pdb.gz	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
9	AFDB:Q9QZ15	0.647	0.598	5.440E-18	238	0.352	0.324	Q9QZ15.pdb.gz	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
10	AFDB:Q7TS58	0.631	0.660	1.082E-17	209	0.374	0.392	Q7TS58.pdb.gz	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
11	PDB:7wz8A	0.519	0.626	1.767E-12	180	0.228	0.278	7wz8A.pdb.gz
12	PDB:1qddA	0.514	0.762	2.059E-10	144	0.160	0.243	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:5f2qB	0.502	0.783	2.422E-9	135	0.151	0.244	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:1htnA	0.516	0.708	1.138E-8	156	0.142	0.199	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
15	PDB:4mthA	0.480	0.724	8.965E-8	139	0.137	0.216	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
16	PDB:3bx4C	0.418	0.660	9.494E-8	134	0.151	0.246	3bx4C.pdb.gz
17	PDB:1gz2A	0.465	0.709	2.118E-7	139	0.128	0.201	1gz2A.pdb.gz
18	PDB:7qsrA	0.467	0.081	2.516E-7	1335	0.146	0.024	7qsrA.pdb.gz
19	PDB:2kv3A	0.450	0.702	5.945E-7	131	0.174	0.290	2kv3A.pdb.gz
20	PDB:1bj3B	0.419	0.718	9.404E-7	123	0.151	0.268	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULY5	1.81e-164	454	219	1.000	1.000	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
2	Q67EQ1	1.36e-103	300	215	0.667	0.679	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
3	Q9R0Q8	1.89e-95	279	214	0.653	0.668	CLC4E_MOUSE C-type lectin domain family 4 member E OS=Mus musculus OX=10090 GN=Clec4e PE=1 SV=1
4	Q6EIG7	5.72e-44	148	209	0.388	0.407	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
5	Q69FH1	1.56e-43	147	218	0.356	0.358	CLC4D_RAT C-type lectin domain family 4 member D OS=Rattus norvegicus OX=10116 GN=Clec4d PE=1 SV=1
6	Q8WTT0	7.39e-43	145	213	0.374	0.385	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
7	Q7TS58	9.32e-43	145	209	0.370	0.388	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
8	Q9Z2H6	8.64e-42	142	219	0.361	0.361	CLC4D_MOUSE C-type lectin domain family 4 member D OS=Mus musculus OX=10090 GN=Clec4d PE=1 SV=1
9	Q9JKF4	3.33e-41	141	209	0.347	0.364	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
10	Q8WXI8	4.44e-41	140	215	0.356	0.363	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
11	Q67DU8	2.88e-37	130	208	0.361	0.380	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
12	Q9D8Q7	2.75e-34	122	176	0.342	0.426	Q9D8Q7_MOUSE C-type lectin domain family 4, member b1 OS=Mus musculus OX=10090 GN=Clec4b1 PE=1 SV=1
13	Q9UMR7	8.42e-33	120	237	0.306	0.283	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
14	D3Z5D4	1.14e-32	119	194	0.297	0.335	D3Z5D4_MOUSE CD209g antigen OS=Mus musculus OX=10090 GN=Cd209g PE=4 SV=1
15	Q14FK5	4.85e-32	119	255	0.297	0.255	Q14FK5_MOUSE SIGNR7 protein OS=Mus musculus OX=10090 GN=Cd209g PE=2 SV=1
16	Q9QZ15	2.92e-31	116	238	0.329	0.303	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
17	Q91ZX1	6.61e-30	112	238	0.288	0.265	C209A_MOUSE CD209 antigen-like protein A OS=Mus musculus OX=10090 GN=Cd209a PE=2 SV=1
18	Q91ZW7	2.00e-29	110	208	0.256	0.269	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
19	G3UVT9	1.72e-28	109	255	0.279	0.239	G3UVT9_MOUSE CD209f antigen OS=Mus musculus OX=10090 GN=Cd209f PE=1 SV=1
20	Q5YIR8	1.93e-28	108	236	0.301	0.280	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	1.1e-18	79.2	Lectin C-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364907	0.982	Tyrosine-protein kinase SYK
2	9606.ENSP00000289902	0.979	High affinity immunoglobulin epsilon receptor subunit gamma
3	9606.ENSP00000428924	0.915	Tyrosine-protein kinase Lyn
4	9606.ENSP00000346671	0.903	Tyrosine-protein kinase Fyn
5	9606.ENSP00000299665	0.882	C-type lectin domain family 4 member D
6	9606.ENSP00000305790	0.855	Splicing factor 3B subunit 3
7	9606.ENSP00000360797	0.830	Caspase recruitment domain-containing protein 9
8	9606.ENSP00000260010	0.805	Toll-like receptor 2
9	9606.ENSP00000482457	0.746	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
10	9606.ENSP00000371505	0.692	C-type lectin domain family 6 member A
11	9606.ENSP00000359612	0.663	B-cell lymphoma/leukemia 10
12	9606.ENSP00000363089	0.655	Toll-like receptor 4
13	9606.ENSP00000363318	0.650	Cytokine receptor common subunit gamma
14	9606.ENSP00000263341	0.626	Interleukin-1 beta
15	9606.ENSP00000450436	0.626	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
16	9606.ENSP00000347916	0.619	C-type lectin domain family 12 member A
17	9606.ENSP00000353874	0.590	Toll-like receptor 9
18	9606.ENSP00000366682	0.588	Cis-aconitate decarboxylase
19	9606.ENSP00000417517	0.587	annotation not available
20	9606.ENSP00000398698	0.575	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030246	1.000	carbohydrate binding
GO:0005515	1.000	protein binding
GO:0038187	0.999	pattern recognition receptor activity
GO:0043167	0.882	ion binding
GO:0046872	0.757	metal ion binding
GO:0005509	0.737	calcium ion binding
GO:0005102	0.339	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0002376	0.995	immune system process
GO:0051716	0.994	cellular response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0007154	0.992	cell communication
GO:0023052	0.991	signaling
GO:0002682	0.986	regulation of immune system process
GO:0007165	0.972	signal transduction
GO:0050776	0.971	regulation of immune response
GO:0002764	0.951	immune response-regulating signaling pathway
GO:0002218	0.932	activation of innate immune response
GO:0002757	0.928	immune response-activating signaling pathway
GO:0002758	0.910	innate immune response-activating signaling pathway
GO:0019222	0.868	regulation of metabolic process
GO:0060255	0.860	regulation of macromolecule metabolic process
GO:0051239	0.778	regulation of multicellular organismal process
GO:0010468	0.699	regulation of gene expression
GO:0006950	0.684	response to stress
GO:0009605	0.677	response to external stimulus
GO:0009893	0.677	positive regulation of metabolic process
GO:0048522	0.661	positive regulation of cellular process
GO:0010604	0.654	positive regulation of macromolecule metabolic process
GO:0007166	0.636	cell surface receptor signaling pathway
GO:0009607	0.627	response to biotic stimulus
GO:0051240	0.600	positive regulation of multicellular organismal process
GO:0044419	0.569	biological process involved in interspecies interaction between organisms
GO:0006952	0.564	defense response
GO:0001819	0.510	positive regulation of cytokine production
GO:0032501	0.499	multicellular organismal process
GO:0051707	0.475	response to other organism
GO:0006955	0.471	immune response
GO:0098542	0.420	defense response to other organism
GO:0032502	0.360	developmental process
GO:0002221	0.344	pattern recognition receptor signaling pathway
GO:0002768	0.323	immune response-regulating cell surface receptor signaling pathway
GO:0045087	0.312	innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005737	0.779	cytoplasm
GO:0043226	0.775	organelle
GO:0043227	0.769	membrane-bounded organelle
GO:0043229	0.768	intracellular organelle
GO:0043231	0.750	intracellular membrane-bounded organelle
GO:0031982	0.533	vesicle
GO:0030659	0.477	cytoplasmic vesicle membrane
GO:0098588	0.379	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]