StarFunc result for job id Q9ULZ1

User Input

>input (77 residues)
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULZ1	0.999	0.999	9.952E-12	77	1.000	1.000	Q9ULZ1.pdb.gz	APEL_HUMAN Apelin OS=Homo sapiens OX=9606 GN=APLN PE=2 SV=1
2	AFDB:Q9R0R3	0.288	0.288	3.159E-8	77	0.818	0.818	Q9R0R3.pdb.gz	APEL_RAT Apelin OS=Rattus norvegicus OX=10116 GN=Apln PE=1 SV=1
3	AFDB:D3ZIN8	0.307	0.092	1.644	287	0.208	0.056	D3ZIN8.pdb.gz	D3ZIN8_RAT Programmed cell death 1 OS=Rattus norvegicus OX=10116 GN=Pdcd1 PE=4 SV=1
4	AFDB:Q95QP2	0.277	0.226	2.389	95	0.195	0.158	Q95QP2.pdb.gz	Q95QP2_CAEEL FMRF-Like Peptide OS=Caenorhabditis elegans OX=6239 GN=flp-20 PE=4 SV=2
5	AFDB:B3H4Y2	0.315	0.304	2.988	80	0.234	0.225	B3H4Y2.pdb.gz	STMP3_ARATH Secreted transmembrane peptide 3 OS=Arabidopsis thaliana OX=3702 GN=STMP3 PE=2 SV=1
6	AFDB:Q54NS0	0.225	0.027	3.738	1020	0.117	0.009	Q54NS0.pdb.gz	Q54NS0_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285083 PE=4 SV=1
7	AFDB:A2ATD1	0.311	0.057	4.028	454	0.338	0.057	A2ATD1.pdb.gz	ISM1_MOUSE Isthmin-1 OS=Mus musculus OX=10090 GN=Ism1 PE=1 SV=1
8	AFDB:A0A2R8QCH1	0.350	0.085	4.677	362	0.143	0.030	A0A2R8QCH1.pdb.gz
9	AFDB:O48767	0.278	0.075	4.677	296	0.182	0.047	O48767.pdb.gz	AUG2_ARATH AUGMIN subunit 2 OS=Arabidopsis thaliana OX=3702 GN=AUG2 PE=1 SV=2
10	AFDB:Q86AQ7	0.292	0.101	5.039	260	0.143	0.042	Q86AQ7.pdb.gz	VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum OX=44689 GN=vamp7B PE=3 SV=1
11	PDB:7z0sC	0.263	0.041	5.560	604	0.117	0.015	7z0sC.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULZ1	2.97e-50	154	77	1.000	1.000	APEL_HUMAN Apelin OS=Homo sapiens OX=9606 GN=APLN PE=2 SV=1
2	Q9R0R4	2.83e-24	88.6	77	0.831	0.831	APEL_MOUSE Apelin OS=Mus musculus OX=10090 GN=Apln PE=1 SV=1
3	Q9R0R3	1.14e-23	87.0	77	0.818	0.818	APEL_RAT Apelin OS=Rattus norvegicus OX=10116 GN=Apln PE=1 SV=1
4	Q9QWN8	0.85	29.6	2388	0.286	0.009	SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus OX=10116 GN=Sptbn2 PE=1 SV=2
5	Q9R045	0.85	29.6	493	0.208	0.032	ANGL2_MOUSE Angiopoietin-related protein 2 OS=Mus musculus OX=10090 GN=Angptl2 PE=2 SV=2
6	Q10045	1.0	29.3	301	0.182	0.047	UNC50_CAEEL Protein unc-50 OS=Caenorhabditis elegans OX=6239 GN=unc-50 PE=2 SV=2
7	Q3UGZ4	1.1	29.3	2388	0.286	0.009	Q3UGZ4_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
8	Q68FG2	1.1	29.3	2388	0.286	0.009	Q68FG2_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=1 SV=1
9	Q95LA2	1.2	29.3	532	0.156	0.023	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
10	P16549	1.4	28.9	532	0.156	0.023	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
11	Q6A087	1.5	28.9	1972	0.286	0.011	Q6A087_MOUSE MKIAA0302 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
12	Q01740	1.8	28.5	532	0.156	0.023	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
13	Q80ZK2	1.8	28.9	808	0.286	0.027	Q80ZK2_MOUSE Spnb3 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
14	Q68FM2	2.0	28.5	853	0.286	0.026	Q68FM2_MOUSE Spnb3 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
15	Q9JIK5	3.9	27.7	851	0.208	0.019	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
16	Q8K2L4	4.3	27.7	689	0.208	0.023	Q8K2L4_MOUSE RNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=1
17	Q9C907	5.6	27.3	392	0.169	0.033	GDPD5_ARATH Glycerophosphodiester phosphodiesterase GDPD5 OS=Arabidopsis thaliana OX=3702 GN=GDPD5 PE=2 SV=1
18	Q382R5	6.4	26.9	786	0.195	0.019	Q382R5_TRYB2 Zeta toxin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4500 PE=4 SV=1
19	A0A0A6YW72	7.7	26.9	3346	0.221	0.005	A0A0A6YW72_MOUSE Dachsous cadherin related 2 OS=Mus musculus OX=10090 GN=Dchs2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15360 Apelin	3.9e-24	96.2	APJ endogenous ligand

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003931162.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003920494.2	0.968	Belongs to the G-protein coupled receptor 1 family.
2	27679.XP_010334925.1	0.573	Angiotensin-converting enzyme 2
3	27679.XP_003940820.1	0.551	Belongs to the serpin family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0071855	1.000	neuropeptide receptor binding
GO:0048018	0.997	receptor ligand activity
GO:0005179	0.994	hormone activity
GO:0031704	0.941	apelin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0032501	0.988	multicellular organismal process
GO:0065008	0.981	regulation of biological quality
GO:0048519	0.980	negative regulation of biological process
GO:0008277	0.979	regulation of G protein-coupled receptor signaling pathway
GO:0051050	0.972	positive regulation of transport
GO:0042127	0.967	regulation of cell population proliferation
GO:0048522	0.963	positive regulation of cellular process
GO:0007186	0.961	G protein-coupled receptor signaling pathway
GO:0031323	0.949	regulation of cellular metabolic process
GO:0008284	0.939	positive regulation of cell population proliferation
GO:0048856	0.931	anatomical structure development
GO:0048523	0.929	negative regulation of cellular process
GO:0080090	0.928	regulation of primary metabolic process
GO:0060255	0.928	regulation of macromolecule metabolic process
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0001938	0.924	positive regulation of endothelial cell proliferation
GO:0002090	0.921	regulation of receptor internalization
GO:0031325	0.910	positive regulation of cellular metabolic process
GO:0048513	0.902	animal organ development
GO:0048260	0.889	positive regulation of receptor-mediated endocytosis
GO:0051173	0.877	positive regulation of nitrogen compound metabolic process
GO:0010604	0.871	positive regulation of macromolecule metabolic process
GO:0007507	0.859	heart development
GO:0048585	0.855	negative regulation of response to stimulus
GO:0023057	0.844	negative regulation of signaling
GO:0010648	0.844	negative regulation of cell communication
GO:0009968	0.787	negative regulation of signal transduction
GO:0060976	0.639	coronary vasculature development
GO:0051174	0.474	regulation of phosphorus metabolic process
GO:0042327	0.457	positive regulation of phosphorylation
GO:0051239	0.455	regulation of multicellular organismal process
GO:0060183	0.444	apelin receptor signaling pathway
GO:0051240	0.375	positive regulation of multicellular organismal process
GO:0051246	0.355	regulation of protein metabolic process
GO:0006950	0.340	response to stress
GO:0008015	0.324	blood circulation
GO:0050878	0.308	regulation of body fluid levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.723	intracellular anatomical structure
GO:0005737	0.712	cytoplasm
GO:0005615	0.667	extracellular space
GO:0071944	0.429	cell periphery
GO:0005886	0.422	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]