StarFunc result for job id Q9ULZ2

User Input

>input (295 residues)
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDK
KSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RD91	0.567	0.567	4.885E-54	295	1.000	1.000	A0A024RD91.pdb.gz
2	AFDB:Q9JM90	0.518	0.515	3.913E-49	297	0.837	0.832	Q9JM90.pdb.gz	STAP1_MOUSE Signal-transducing adaptor protein 1 OS=Mus musculus OX=10090 GN=Stap1 PE=1 SV=1
3	AFDB:Q8R0L1	0.414	0.299	3.051E-26	411	0.346	0.248	Q8R0L1.pdb.gz	STAP2_MOUSE Signal-transducing adaptor protein 2 OS=Mus musculus OX=10090 GN=Stap2 PE=1 SV=1
4	AFDB:Q9UGK3	0.422	0.312	1.260E-25	403	0.329	0.241	Q9UGK3.pdb.gz	STAP2_HUMAN Signal-transducing adaptor protein 2 OS=Homo sapiens OX=9606 GN=STAP2 PE=1 SV=2
5	AFDB:Q9NHV9	0.301	0.120	6.955E-8	793	0.132	0.049	Q9NHV9.pdb.gz	VAV_DROME Protein vav OS=Drosophila melanogaster OX=7227 GN=Vav PE=1 SV=2
6	AFDB:H0YJ34	0.292	0.144	1.095E-7	640	0.125	0.058	H0YJ34.pdb.gz	H0YJ34_HUMAN FERM domain containing kindlin 2 (Fragment) OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1
7	AFDB:P0CE43	0.252	0.134	1.298E-7	599	0.159	0.078	P0CE43.pdb.gz	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
8	AFDB:Q13322	0.236	0.128	1.629E-7	594	0.169	0.084	Q13322.pdb.gz	GRB10_HUMAN Growth factor receptor-bound protein 10 OS=Homo sapiens OX=9606 GN=GRB10 PE=1 SV=2
9	AFDB:Q03526	0.307	0.164	2.044E-7	625	0.149	0.070	Q03526.pdb.gz	ITK_MOUSE Tyrosine-protein kinase ITK/TSK OS=Mus musculus OX=10090 GN=Itk PE=1 SV=1
10	AFDB:A0A0G2KA94	0.300	0.137	3.406E-7	674	0.156	0.068	A0A0G2KA94.pdb.gz	A0A0G2KA94_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Tec PE=1 SV=1
11	PDB:7c3mA	0.296	0.159	5.573E-6	577	0.146	0.075	7c3mA.pdb.gz
12	PDB:3ljuX	0.278	0.224	1.879E-4	373	0.061	0.048	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:4fl2A	0.239	0.133	3.711E-4	555	0.129	0.068	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:6bbpA	0.282	0.168	3.928E-4	520	0.061	0.035	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:6hhgA	0.260	0.205	4.157E-4	386	0.098	0.075	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
16	PDB:4gwfA	0.253	0.153	6.184E-4	497	0.092	0.054	4gwfA.pdb.gz
17	PDB:7rx9A	0.267	0.190	1.623E-3	432	0.068	0.046	7rx9A.pdb.gz
18	PDB:5xzrA	0.247	0.145	1.818E-3	519	0.078	0.044	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
19	PDB:3ps5A	0.251	0.147	2.036E-3	529	0.088	0.049	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
20	PDB:4mt6A	0.247	0.196	2.281E-3	389	0.058	0.044	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JM90	0.0	511	297	0.837	0.832	STAP1_MOUSE Signal-transducing adaptor protein 1 OS=Mus musculus OX=10090 GN=Stap1 PE=1 SV=1
2	Q9ULZ2	0.0	606	295	1.000	1.000	STAP1_HUMAN Signal-transducing adaptor protein 1 OS=Homo sapiens OX=9606 GN=STAP1 PE=1 SV=1
3	Q8R0L1	2.09e-47	165	411	0.312	0.224	STAP2_MOUSE Signal-transducing adaptor protein 2 OS=Mus musculus OX=10090 GN=Stap2 PE=1 SV=1
4	Q9UGK3	2.69e-44	157	403	0.319	0.233	STAP2_HUMAN Signal-transducing adaptor protein 2 OS=Homo sapiens OX=9606 GN=STAP2 PE=1 SV=2
5	Q64398	1.08e-05	49.3	1154	0.092	0.023	DGKH_MESAU Diacylglycerol kinase eta OS=Mesocricetus auratus OX=10036 GN=DGKH PE=1 SV=1
6	Q86XP1	1.36e-05	48.9	1220	0.092	0.022	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
7	D3YXJ0	4.25e-05	47.4	1211	0.092	0.022	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2
8	Q16760	5.21e-04	43.9	1214	0.088	0.021	DGKD_HUMAN Diacylglycerol kinase delta OS=Homo sapiens OX=9606 GN=DGKD PE=1 SV=4
9	E9PUQ8	6.00e-04	43.9	1220	0.088	0.021	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
10	Q9H3Y6	0.010	39.7	488	0.095	0.057	SRMS_HUMAN Tyrosine-protein kinase Srms OS=Homo sapiens OX=9606 GN=SRMS PE=1 SV=1
11	P16885	0.046	37.7	1265	0.075	0.017	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
12	Q60610	0.054	37.7	1591	0.068	0.013	TIAM1_MOUSE Rho guanine nucleotide exchange factor TIAM1 OS=Mus musculus OX=10090 GN=Tiam1 PE=1 SV=1
13	Q66I04	0.059	37.4	510	0.166	0.096	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
14	Q7SYB5	0.096	36.6	612	0.119	0.057	DEFI6_DANRE Differentially expressed in FDCP 6 homolog OS=Danio rerio OX=7955 GN=def6 PE=2 SV=1
15	A0A8I6AC12	0.12	36.6	1590	0.064	0.012	A0A8I6AC12_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=4 SV=1
16	D3ZWV8	0.12	36.6	1588	0.064	0.012	D3ZWV8_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=1 SV=4
17	Q13009	0.12	36.6	1591	0.064	0.012	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
18	Q8CIH5	0.12	36.6	1265	0.071	0.017	PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus OX=10090 GN=Plcg2 PE=1 SV=1
19	P24135	0.31	35.0	1265	0.071	0.017	PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus OX=10116 GN=Plcg2 PE=1 SV=1
20	Q7Z5H3	0.38	34.7	698	0.051	0.021	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.02	26.8	PH domain
2	PF00017 SH2	0.29	22.6	SH2 domain
3	PF14633 SH2_2	11	16.8	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265404

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288135	0.939	Mast/stem cell growth factor receptor Kit
2	9606.ENSP00000341208	0.912	Signal transducer and activator of transcription 5A
3	9606.ENSP00000228280	0.900	Kit ligand
4	9606.ENSP00000380921	0.898	SH3 domain-containing kinase-binding protein 1
5	9606.ENSP00000352264	0.880	CD2-associated protein
6	9606.ENSP00000350224	0.740	Cytoplasmic tyrosine-protein kinase BMX
7	9606.ENSP00000401010	0.678	F-actin-capping protein subunit beta
8	9606.ENSP00000483570	0.655	Tyrosine-protein kinase BTK
9	9606.ENSP00000359052	0.633	Protein FAM102B
10	9606.ENSP00000370395	0.628	Small glutamine-rich tetratricopeptide repeat-containing protein beta
11	9606.ENSP00000264316	0.612	Tyrosine-protein kinase TXK
12	9606.ENSP00000406026	0.568	SH2 domain-containing protein 5
13	9606.ENSP00000433277	0.567	B-lymphocyte antigen CD20
14	9606.ENSP00000398655	0.566	Tyrosine-protein kinase ITK/TSK
15	9606.ENSP00000234313	0.561	Pleckstrin
16	9606.ENSP00000356354	0.560	Protein-L-isoaspartate(D-aspartate) O-methyltransferase
17	9606.ENSP00000356906	0.502	SH2 domain-containing protein 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035591	0.999	signaling adaptor activity
GO:0019901	0.999	protein kinase binding
GO:0005102	0.979	signaling receptor binding
GO:1990782	0.738	protein tyrosine kinase binding
GO:0030971	0.734	receptor tyrosine kinase binding
GO:0030234	0.714	enzyme regulator activity
GO:0019207	0.701	kinase regulator activity
GO:0008047	0.691	enzyme activator activity
GO:0005126	0.589	cytokine receptor binding
GO:0030159	0.586	signaling receptor complex adaptor activity
GO:0005068	0.578	transmembrane receptor protein tyrosine kinase adaptor activity
GO:0001784	0.358	phosphotyrosine residue binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0002682	0.995	regulation of immune system process
GO:0048518	0.994	positive regulation of biological process
GO:0048583	0.991	regulation of response to stimulus
GO:0048522	0.982	positive regulation of cellular process
GO:0002684	0.977	positive regulation of immune system process
GO:0023051	0.973	regulation of signaling
GO:0010646	0.970	regulation of cell communication
GO:0050776	0.962	regulation of immune response
GO:0048584	0.961	positive regulation of response to stimulus
GO:0009966	0.950	regulation of signal transduction
GO:0050778	0.943	positive regulation of immune response
GO:0009987	0.924	cellular process
GO:0050896	0.884	response to stimulus
GO:0050854	0.810	regulation of antigen receptor-mediated signaling pathway
GO:0009967	0.804	positive regulation of signal transduction
GO:0051716	0.732	cellular response to stimulus
GO:0023052	0.611	signaling
GO:0007154	0.611	cell communication
GO:0007165	0.604	signal transduction
GO:0019222	0.485	regulation of metabolic process
GO:0007166	0.438	cell surface receptor signaling pathway
GO:0031323	0.414	regulation of cellular metabolic process
GO:0060255	0.361	regulation of macromolecule metabolic process
GO:0048523	0.302	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0032991	0.895	protein-containing complex
GO:0005829	0.453	cytosol
GO:0005886	0.323	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]