StarFunc result for job id Q9ULZ3

User Input

>input (195 residues)
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULZ3	1.000	1.000	2.214E-26	195	1.000	1.000	Q9ULZ3.pdb.gz	ASC_HUMAN Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD PE=1 SV=2
2	PDB:2kn6A	0.457	0.457	2.266E-20	195	1.000	1.000	2kn6A.pdb.gz
3	AFDB:Q8CHK8	0.470	0.475	7.774E-18	193	0.697	0.705	Q8CHK8.pdb.gz	Q8CHK8_RAT Apoptosis-associated speck-like protein OS=Rattus norvegicus OX=10116 GN=Pycard PE=2 SV=1
4	AFDB:Q9EPB4	0.669	0.675	1.177E-17	193	0.713	0.720	Q9EPB4.pdb.gz	ASC_MOUSE Apoptosis-associated speck-like protein containing a CARD OS=Mus musculus OX=10090 GN=Pycard PE=1 SV=1
5	AFDB:Q9I9N6	0.471	0.456	7.183E-9	203	0.333	0.320	Q9I9N6.pdb.gz	ASC_DANRE Apoptosis-associated speck-like protein containing a CARD OS=Danio rerio OX=7955 GN=pycard PE=1 SV=1
6	PDB:6ki0A	0.412	0.181	1.155E-8	459	0.477	0.203	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
7	AFDB:Q8WXC3	0.441	0.954	3.958E-7	89	0.292	0.640	Q8WXC3.pdb.gz	PYDC1_HUMAN Pyrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYDC1 PE=1 SV=1
8	PDB:2hm2Q	0.436	0.925	4.617E-6	89	0.292	0.640	2hm2Q.pdb.gz
9	AFDB:Q0GKD5	0.413	0.072	1.654E-5	1196	0.267	0.043	Q0GKD5.pdb.gz	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
10	AFDB:Q2LKW6	0.408	0.070	4.156E-5	1233	0.251	0.040	Q2LKW6.pdb.gz	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
11	AFDB:Q9C000	0.422	0.061	4.156E-5	1473	0.262	0.035	Q9C000.pdb.gz	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
12	AFDB:Q2LKU9	0.404	0.070	5.738E-5	1182	0.251	0.041	Q2LKU9.pdb.gz	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
13	AFDB:A1Z198	0.402	0.072	6.292E-5	1177	0.267	0.044	A1Z198.pdb.gz	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
14	PDB:7pzcA	0.408	0.085	1.534E-3	1010	0.154	0.030	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
15	PDB:4irlB	0.380	0.168	1.165E-2	463	0.169	0.071	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.
16	PDB:4ikmA	0.377	0.165	2.551E-2	463	0.154	0.065	4ikmA.pdb.gz	The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
17	PDB:5h7nB	0.411	0.179	4.863E-2	460	0.113	0.048	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
18	PDB:6mksA	0.384	0.769	1.016E-1	90	0.108	0.233	6mksA.pdb.gz
19	PDB:6ndjB	0.316	0.146	2.555E-1	443	0.144	0.063	6ndjB.pdb.gz
20	PDB:6p6cA	0.331	0.613	5.099E-1	90	0.051	0.111	6p6cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULZ3	3.18e-143	398	195	1.000	1.000	ASC_HUMAN Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD PE=1 SV=2
2	Q8CHK8	1.05e-93	273	193	0.697	0.705	Q8CHK8_RAT Apoptosis-associated speck-like protein OS=Rattus norvegicus OX=10116 GN=Pycard PE=2 SV=1
3	Q9EPB4	5.11e-93	271	193	0.718	0.725	ASC_MOUSE Apoptosis-associated speck-like protein containing a CARD OS=Mus musculus OX=10090 GN=Pycard PE=1 SV=1
4	G3V8L1	4.61e-82	243	177	0.641	0.706	G3V8L1_RAT PYD and CARD domain containing OS=Rattus norvegicus OX=10116 GN=Pycard PE=1 SV=2
5	Q8WXC3	1.88e-30	108	89	0.292	0.640	PYDC1_HUMAN Pyrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYDC1 PE=1 SV=1
6	D9I2H0	1.01e-24	102	1218	0.256	0.041	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
7	D9I2G1	1.05e-24	102	1218	0.256	0.041	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
8	D9I2G4	1.10e-24	102	1218	0.256	0.041	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
9	D9I2F9	1.17e-24	102	1218	0.256	0.041	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
10	D9I2G3	1.24e-24	102	1218	0.256	0.041	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
11	Q2LKU9	1.27e-24	102	1182	0.251	0.041	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
12	Q2LKV5	1.84e-24	102	1172	0.246	0.041	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
13	Q2LKW6	1.87e-24	102	1233	0.246	0.039	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
14	Q0GKD5	1.92e-24	102	1196	0.246	0.040	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
15	A1Z198	1.99e-24	102	1177	0.246	0.041	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
16	Q9C000	3.93e-24	101	1473	0.262	0.035	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
17	Q9I9N6	1.98e-20	86.7	203	0.333	0.320	ASC_DANRE Apoptosis-associated speck-like protein containing a CARD OS=Danio rerio OX=7955 GN=pycard PE=1 SV=1
18	Q9JJ26	2.09e-09	58.5	767	0.149	0.038	MEFV_MOUSE Pyrin OS=Mus musculus OX=10090 GN=Mefv PE=1 SV=2
19	Q63035	5.73e-09	57.0	881	0.185	0.041	NLRP6_RAT NACHT, LRR and PYD domains-containing protein 6 OS=Rattus norvegicus OX=10116 GN=Nlrp6 PE=1 SV=4
20	Q91WS2	6.78e-09	57.0	869	0.185	0.041	NLRP6_MOUSE NACHT, LRR and PYD domains-containing protein 6 OS=Mus musculus OX=10090 GN=Nlrp6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.1e-18	78.3	Caspase recruitment domain
2	PF02758 PYRIN	1.7e-15	68.2	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337383	0.999	NACHT, LRR and PYD domains-containing protein 3
2	9606.ENSP00000357112	0.999	Interferon-inducible protein AIM2
3	9606.ENSP00000433138	0.999	Caspase-1
4	9606.ENSP00000376849	0.996	Caspase-5
5	9606.ENSP00000385090	0.989	NLR family CARD domain-containing protein 4
6	9606.ENSP00000219596	0.981	Pyrin
7	9606.ENSP00000263341	0.980	Interleukin-1 beta
8	9606.ENSP00000351273	0.979	Caspase-8
9	9606.ENSP00000375767	0.974	Caspase recruitment domain-containing protein 8
10	9606.ENSP00000309767	0.962	NACHT, LRR and PYD domains-containing protein 6
11	9606.ENSP00000280357	0.956	Interleukin-18
12	9606.ENSP00000478516	0.938	NACHT, LRR and PYD domains-containing protein 1
13	9606.ENSP00000375653	0.932	NACHT, LRR and PYD domains-containing protein 12
14	9606.ENSP00000331857	0.929	NACHT, LRR and PYD domains-containing protein 9
15	9606.ENSP00000225296	0.919	Putative ATP-dependent RNA helicase DHX33
16	9606.ENSP00000428325	0.917	Pyrin domain-containing protein 2
17	9606.ENSP00000433209	0.915	Gasdermin-D
18	9606.ENSP00000301295	0.878	NACHT, LRR and PYD domains-containing protein 4
19	9606.ENSP00000364858	0.860	Caspase recruitment domain-containing protein 16
20	9606.ENSP00000304336	0.850	Pyrin domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	0.999	protein dimerization activity
GO:0042802	0.999	identical protein binding
GO:0002020	0.999	protease binding
GO:0019904	0.965	protein domain specific binding
GO:0005102	0.922	signaling receptor binding
GO:0042803	0.820	protein homodimerization activity
GO:0008092	0.795	cytoskeletal protein binding
GO:0005126	0.778	cytokine receptor binding
GO:0005523	0.752	tropomyosin binding
GO:0033612	0.740	receptor serine/threonine kinase binding
GO:0017022	0.737	myosin binding
GO:0070696	0.726	transmembrane receptor protein serine/threonine kinase binding
GO:0070851	0.699	growth factor receptor binding
GO:0003824	0.596	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:2001056	0.988	positive regulation of cysteine-type endopeptidase activity
GO:0009987	0.987	cellular process
GO:0050896	0.986	response to stimulus
GO:0048522	0.983	positive regulation of cellular process
GO:0043280	0.982	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0001817	0.977	regulation of cytokine production
GO:0051707	0.976	response to other organism
GO:0048584	0.975	positive regulation of response to stimulus
GO:0009617	0.971	response to bacterium
GO:0006950	0.970	response to stress
GO:0001819	0.965	positive regulation of cytokine production
GO:0043067	0.962	regulation of programmed cell death
GO:0042981	0.951	regulation of apoptotic process
GO:0032651	0.951	regulation of interleukin-1 beta production
GO:0032732	0.948	positive regulation of interleukin-1 production
GO:0098542	0.946	defense response to other organism
GO:0002218	0.945	activation of innate immune response
GO:0051249	0.939	regulation of lymphocyte activation
GO:0032731	0.937	positive regulation of interleukin-1 beta production
GO:0002696	0.935	positive regulation of leukocyte activation
GO:0009966	0.927	regulation of signal transduction
GO:0051090	0.926	regulation of DNA-binding transcription factor activity
GO:1903037	0.925	regulation of leukocyte cell-cell adhesion
GO:0051251	0.925	positive regulation of lymphocyte activation
GO:0022409	0.921	positive regulation of cell-cell adhesion
GO:0051716	0.916	cellular response to stimulus
GO:1903039	0.911	positive regulation of leukocyte cell-cell adhesion
GO:0050727	0.908	regulation of inflammatory response
GO:0007165	0.905	signal transduction
GO:1902533	0.903	positive regulation of intracellular signal transduction
GO:0051130	0.889	positive regulation of cellular component organization
GO:0006915	0.886	apoptotic process
GO:0034097	0.885	response to cytokine
GO:0032642	0.855	regulation of chemokine production
GO:0032675	0.851	regulation of interleukin-6 production
GO:0048519	0.850	negative regulation of biological process
GO:0071840	0.845	cellular component organization or biogenesis
GO:0032722	0.835	positive regulation of chemokine production
GO:0050729	0.828	positive regulation of inflammatory response
GO:0016043	0.827	cellular component organization
GO:0050870	0.826	positive regulation of T cell activation
GO:0048523	0.820	negative regulation of cellular process
GO:0010638	0.814	positive regulation of organelle organization
GO:0032501	0.792	multicellular organismal process
GO:0035556	0.791	intracellular signal transduction
GO:0032755	0.771	positive regulation of interleukin-6 production
GO:0071310	0.768	cellular response to organic substance
GO:0043410	0.748	positive regulation of MAPK cascade
GO:0031399	0.718	regulation of protein modification process
GO:0031325	0.650	positive regulation of cellular metabolic process
GO:0071704	0.642	organic substance metabolic process
GO:0070374	0.625	positive regulation of ERK1 and ERK2 cascade
GO:0009892	0.621	negative regulation of metabolic process
GO:0001775	0.616	cell activation
GO:0006807	0.595	nitrogen compound metabolic process
GO:0010605	0.583	negative regulation of macromolecule metabolic process
GO:0044238	0.570	primary metabolic process
GO:0006955	0.541	immune response
GO:0010803	0.529	regulation of tumor necrosis factor-mediated signaling pathway
GO:1901564	0.524	organonitrogen compound metabolic process
GO:1901700	0.486	response to oxygen-containing compound
GO:0043170	0.476	macromolecule metabolic process
GO:0019538	0.451	protein metabolic process
GO:0033554	0.415	cellular response to stress
GO:0043933	0.335	protein-containing complex organization
GO:0045321	0.312	leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0070013	0.997	intracellular organelle lumen
GO:0012505	0.993	endomembrane system
GO:0031981	0.990	nuclear lumen
GO:0016020	0.966	membrane
GO:0005654	0.964	nucleoplasm
GO:0005576	0.953	extracellular region
GO:0061702	0.933	inflammasome complex
GO:0031982	0.880	vesicle
GO:1990234	0.756	transferase complex
GO:0061695	0.730	transferase complex, transferring phosphorus-containing groups
GO:0043228	0.688	non-membrane-bounded organelle
GO:1902911	0.615	protein kinase complex
GO:0043232	0.610	intracellular non-membrane-bounded organelle
GO:0031410	0.601	cytoplasmic vesicle
GO:1902554	0.575	serine/threonine protein kinase complex
GO:0031090	0.498	organelle membrane
GO:0099503	0.493	secretory vesicle
GO:0071944	0.488	cell periphery
GO:0005886	0.472	plasma membrane
GO:0030141	0.466	secretory granule
GO:0098588	0.448	bounding membrane of organelle
GO:0005615	0.445	extracellular space
GO:0005739	0.425	mitochondrion
GO:0005794	0.413	Golgi apparatus
GO:0140738	0.380	NLRP6 inflammasome complex
GO:0005773	0.373	vacuole
GO:0000323	0.350	lytic vacuole
GO:0005764	0.331	lysosome
GO:0034774	0.318	secretory granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]