StarFunc result for job id Q9UM11

User Input

>input (496 residues)
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRT
PPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
VKWESVSVLNLFTRIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UM11	1.000	1.000	2.673E-95	496	1.000	1.000	Q9UM11.pdb.gz	FZR1_HUMAN Fizzy-related protein homolog OS=Homo sapiens OX=9606 GN=FZR1 PE=1 SV=2
2	AFDB:O18402	0.747	0.772	4.564E-69	478	0.681	0.707	O18402.pdb.gz	O18402_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
3	PDB:7qe7R	0.827	0.930	9.439E-69	440	0.885	0.998	7qe7R.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
4	PDB:4ui9R	0.757	0.966	5.458E-62	387	0.772	0.990	4ui9R.pdb.gz	Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
5	AFDB:Q09649	0.692	0.492	7.963E-57	702	0.518	0.366	Q09649.pdb.gz	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1
6	AFDB:Q8L3Z8	0.631	0.647	1.610E-55	483	0.522	0.536	Q8L3Z8.pdb.gz	FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=FZR2 PE=1 SV=1
7	AFDB:Q9W1F6	0.768	0.842	1.699E-55	451	0.452	0.497	Q9W1F6.pdb.gz	Q9W1F6_DROME Fizzy-related 2 OS=Drosophila melanogaster OX=7227 GN=fzr2 PE=2 SV=1
8	AFDB:Q5B915	0.653	0.553	1.113E-54	592	0.496	0.416	Q5B915.pdb.gz	Q5B915_EMENI Cell cycle regulatory protein (Srw1), putative (AFU_orthologue AFUA_3G08280) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02965 PE=4 SV=1
9	AFDB:Q8VZS9	0.624	0.651	2.008E-54	475	0.526	0.549	Q8VZS9.pdb.gz	FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=FZR1 PE=1 SV=1
10	AFDB:Q8LPL5	0.630	0.650	2.132E-53	481	0.508	0.524	Q8LPL5.pdb.gz	FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=FZR3 PE=1 SV=1
11	AFDB:Q5ACY4	0.678	0.568	6.624E-52	597	0.498	0.414	Q5ACY4.pdb.gz	Q5ACY4_CANAL Cdh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDH1 PE=3 SV=1
12	AFDB:O94423	0.646	0.757	4.829E-51	421	0.415	0.489	O94423.pdb.gz	MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfr1 PE=1 SV=1
13	PDB:5lcwR	0.606	0.782	1.300E-42	383	0.337	0.436	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
14	PDB:5mzhB	0.503	0.592	3.136E-21	415	0.139	0.166	5mzhB.pdb.gz
15	PDB:2h9lA	0.545	0.824	5.397E-20	321	0.133	0.206	2h9lA.pdb.gz
16	PDB:5nnzA	0.488	0.697	5.397E-20	335	0.131	0.194	5nnzA.pdb.gz
17	PDB:5jcsq	0.464	0.471	8.293E-20	488	0.139	0.141	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
18	PDB:5yzgs	0.522	0.683	1.419E-19	374	0.105	0.139	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:7jvrB	0.544	0.776	7.103E-19	342	0.139	0.202	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:3jcmB	0.516	0.591	7.495E-19	429	0.139	0.161	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1WCA1	0.0	994	493	0.974	0.980	B1WCA1_RAT Fizzy and cell division cycle 20 related 1 OS=Rattus norvegicus OX=10116 GN=Fzr1 PE=1 SV=1
2	O18402	0.0	679	478	0.688	0.713	O18402_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
3	Q5H7B9	0.0	1002	493	0.982	0.988	Q5H7B9_PIG FZR1 protein OS=Sus scrofa OX=9823 GN=FZR1 PE=2 SV=1
4	Q9R1K5	0.0	998	493	0.978	0.984	FZR1_MOUSE Fizzy-related protein homolog OS=Mus musculus OX=10090 GN=Fzr1 PE=1 SV=1
5	Q9UM11	0.0	1025	496	1.000	1.000	FZR1_HUMAN Fizzy-related protein homolog OS=Homo sapiens OX=9606 GN=FZR1 PE=1 SV=2
6	Q9W4H9	0.0	681	478	0.690	0.715	Q9W4H9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
7	Q09649	3.18e-170	498	702	0.492	0.348	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1
8	Q8L3Z8	9.65e-168	484	483	0.516	0.530	FZR2_ARATH Protein FIZZY-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=FZR2 PE=1 SV=1
9	Q8VZS9	1.89e-162	470	475	0.520	0.543	FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=FZR1 PE=1 SV=1
10	Q5B915	1.89e-159	467	592	0.492	0.412	Q5B915_EMENI Cell cycle regulatory protein (Srw1), putative (AFU_orthologue AFUA_3G08280) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02965 PE=4 SV=1
11	Q5ACY4	1.67e-150	444	597	0.448	0.372	Q5ACY4_CANAL Cdh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDH1 PE=3 SV=1
12	Q9W1F6	8.87e-147	429	451	0.454	0.499	Q9W1F6_DROME Fizzy-related 2 OS=Drosophila melanogaster OX=7227 GN=fzr2 PE=2 SV=1
13	Q8LPL5	5.09e-145	426	481	0.490	0.505	FZR3_ARATH Protein FIZZY-RELATED 3 OS=Arabidopsis thaliana OX=3702 GN=FZR3 PE=1 SV=1
14	O94423	3.43e-137	404	421	0.425	0.501	MFR1_SCHPO Meiotic fizzy-related protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mfr1 PE=1 SV=1
15	O13286	3.36e-133	399	556	0.450	0.401	SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srw1 PE=1 SV=1
16	Q54MZ3	1.56e-114	348	499	0.339	0.337	CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum OX=44689 GN=cdc20 PE=1 SV=1
17	Q6NR32	2.76e-113	346	526	0.379	0.357	Q6NR32_DROME RE39287p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
18	Q24044	3.21e-113	346	526	0.379	0.357	Q24044_DROME FI02843p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
19	Q9SZA4	1.45e-112	342	457	0.397	0.431	CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-1 PE=1 SV=1
20	P53197	1.54e-111	343	566	0.411	0.360	CDH1_YEAST APC/C activator protein CDH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDH1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.6e-11	55.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	0.017	26.5	Eukaryotic translation initiation factor eIF2A
3	PF16529 Ge1_WD40	67	13.9	WD40 region of Ge1, enhancer of mRNA-decapping protein
4	PF20426 NBCH_WD40	0.1	23.0	Neurobeachin beta propeller domain
5	PF11715 Nup160	1e+02	13.1	Nucleoporin Nup120/160
6	PF00400 WD40	6.3e-24	95.0	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010365593.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352613.1	0.999	Anaphase-promoting complex subunit 11
2	61622.XP_010361280.1	0.999	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.
3	61622.XP_010366626.1	0.999	Anaphase-promoting complex subunit 5 isoform X1
4	61622.XP_010368761.1	0.999	Cell division cycle 26
5	61622.XP_010370968.1	0.999	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
6	61622.XP_010373124.1	0.999	Cell division cycle protein 16 homolog isoform X1
7	61622.XP_010377536.1	0.999	Anaphase-promoting complex subunit 7
8	61622.XP_010384656.1	0.999	Anaphase-promoting complex subunit 1
9	61622.XP_010386392.1	0.999	Cell division cycle 23
10	61622.XP_010359552.1	0.998	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle
11	61622.XP_010363172.1	0.998	MAD2 mitotic arrest deficient-like 1 (yeast)
12	61622.XP_010378516.1	0.997	Belongs to the cyclin family.
13	61622.XP_010363136.1	0.993	Anaphase-promoting complex subunit 13
14	61622.XP_010368233.1	0.992	Pituitary tumor-transforming 1
15	61622.XP_010372546.1	0.992	Belongs to the cyclin family.
16	61622.XP_010356490.1	0.987	F-box protein 5
17	61622.XP_010361834.1	0.987	Cell division cycle protein 27 homolog
18	61622.XP_010375269.1	0.987	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 ESTs, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	61622.XP_010356528.1	0.984	Polo like kinase 1
20	61622.XP_010358082.1	0.983	BUB1 mitotic checkpoint serine/threonine kinase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010564	0.996	regulation of cell cycle process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0009987	0.992	cellular process
GO:0019538	0.991	protein metabolic process
GO:0006508	0.981	proteolysis
GO:0048518	0.972	positive regulation of biological process
GO:0044237	0.968	cellular metabolic process
GO:0019222	0.957	regulation of metabolic process
GO:0051603	0.949	proteolysis involved in protein catabolic process
GO:1901987	0.917	regulation of cell cycle phase transition
GO:0007346	0.905	regulation of mitotic cell cycle
GO:0048519	0.903	negative regulation of biological process
GO:0051783	0.837	regulation of nuclear division
GO:0048522	0.833	positive regulation of cellular process
GO:0044260	0.814	cellular macromolecule metabolic process
GO:0045786	0.808	negative regulation of cell cycle
GO:1901990	0.805	regulation of mitotic cell cycle phase transition
GO:0010948	0.798	negative regulation of cell cycle process
GO:0060255	0.765	regulation of macromolecule metabolic process
GO:0051171	0.740	regulation of nitrogen compound metabolic process
GO:0080090	0.737	regulation of primary metabolic process
GO:0050896	0.672	response to stimulus
GO:1903047	0.645	mitotic cell cycle process
GO:2000241	0.639	regulation of reproductive process
GO:0010498	0.634	proteasomal protein catabolic process
GO:0043161	0.616	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051716	0.605	cellular response to stimulus
GO:0009893	0.576	positive regulation of metabolic process
GO:0031323	0.562	regulation of cellular metabolic process
GO:0031145	0.507	anaphase-promoting complex-dependent catabolic process
GO:0043412	0.498	macromolecule modification
GO:0036211	0.467	protein modification process
GO:0051246	0.460	regulation of protein metabolic process
GO:0010604	0.458	positive regulation of macromolecule metabolic process
GO:0051173	0.454	positive regulation of nitrogen compound metabolic process
GO:0065009	0.452	regulation of molecular function
GO:0031399	0.424	regulation of protein modification process
GO:0007154	0.413	cell communication
GO:0007165	0.398	signal transduction
GO:0050790	0.370	regulation of catalytic activity
GO:0051338	0.358	regulation of transferase activity
GO:0006950	0.334	response to stress
GO:0032502	0.324	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0032991	0.985	protein-containing complex
GO:0031974	0.976	membrane-enclosed lumen
GO:0031981	0.967	nuclear lumen
GO:0005654	0.959	nucleoplasm
GO:0005829	0.933	cytosol
GO:0015630	0.926	microtubule cytoskeleton
GO:1990234	0.902	transferase complex
GO:0140513	0.832	nuclear protein-containing complex
GO:0140535	0.801	intracellular protein-containing complex
GO:0016020	0.719	membrane
GO:0005819	0.714	spindle
GO:0012505	0.535	endomembrane system
GO:0005680	0.378	anaphase-promoting complex
GO:0005815	0.345	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]