StarFunc result for job id Q9UM44

User Input

>input (414 residues)
MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVV
IHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYT
CYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPIS
ENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVS
LSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDF
SMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGLWILVPSAILAAFL
LIWSVKCCRAQLEARRSRHPADGAQQERCCVPPGERCPSAPDNGEENVPLSGKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UM44	1.000	1.000	2.115E-77	414	1.000	1.000	Q9UM44.pdb.gz	HHLA2_HUMAN HERV-H LTR-associating protein 2 OS=Homo sapiens OX=9606 GN=HHLA2 PE=1 SV=1
2	AFDB:Q5ZPR3	0.420	0.330	1.129E-21	534	0.234	0.182	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
3	AFDB:O70355	0.404	0.371	1.073E-18	454	0.138	0.126	O70355.pdb.gz	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
4	AFDB:F1QF23	0.359	0.378	1.621E-18	391	0.157	0.166	F1QF23.pdb.gz
5	AFDB:Q8NFZ8	0.364	0.385	4.545E-18	388	0.157	0.168	Q8NFZ8.pdb.gz	CADM4_HUMAN Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1
6	AFDB:Q9UIR0	0.419	0.383	1.092E-17	455	0.138	0.125	Q9UIR0.pdb.gz	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
7	AFDB:Q8N126	0.352	0.364	1.488E-17	398	0.164	0.171	Q8N126.pdb.gz	CADM3_HUMAN Cell adhesion molecule 3 OS=Homo sapiens OX=9606 GN=CADM3 PE=1 SV=1
8	AFDB:B0CLV3	0.360	0.361	2.027E-17	413	0.162	0.162	B0CLV3.pdb.gz	B0CLV3_DANRE Cell adhesion molecule 4 OS=Danio rerio OX=7955 GN=zgc:101704 PE=1 SV=1
9	AFDB:Q6PFK4	0.358	0.365	8.586E-17	405	0.164	0.168	Q6PFK4.pdb.gz	Q6PFK4_DANRE Cell adhesion molecule 2a OS=Danio rerio OX=7955 GN=zgc:66339 PE=1 SV=1
10	AFDB:B0CLV6	0.362	0.358	9.040E-17	420	0.171	0.169	B0CLV6.pdb.gz	B0CLV6_DANRE Cell adhesion molecule 3 OS=Danio rerio OX=7955 GN=zgc:136589 PE=1 SV=1
11	PDB:5oj2B	0.252	0.164	8.295E-10	692	0.099	0.059	5oj2B.pdb.gz
12	PDB:6dldD	0.325	0.477	1.019E-9	269	0.135	0.208	6dldD.pdb.gz
13	PDB:3o3uN	0.340	0.251	1.993E-9	580	0.068	0.048	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
14	PDB:1jnhA	0.194	0.336	3.699E-9	208	0.094	0.188	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
15	PDB:6vpyL	0.207	0.378	4.101E-9	209	0.082	0.163	6vpyL.pdb.gz
16	PDB:4r2gP	0.222	0.391	5.307E-9	210	0.087	0.171	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
17	PDB:1q0xL	0.213	0.345	5.588E-9	212	0.085	0.165	1q0xL.pdb.gz
18	PDB:4adfM	0.374	0.759	1.150E-8	191	0.082	0.178	4adfM.pdb.gz
19	PDB:2qhrL	0.248	0.405	1.488E-8	218	0.099	0.188	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
20	PDB:1e07A	0.267	0.191	1.737E-8	642	0.116	0.075	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UM44	0.0	862	414	1.000	1.000	HHLA2_HUMAN HERV-H LTR-associating protein 2 OS=Homo sapiens OX=9606 GN=HHLA2 PE=1 SV=1
2	Q7Z7D3	3.09e-18	86.7	282	0.135	0.199	VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 OS=Homo sapiens OX=9606 GN=VTCN1 PE=1 SV=1
3	Q7TSP5	1.14e-16	82.0	283	0.152	0.223	VTCN1_MOUSE V-set domain containing T-cell activation inhibitor 1 OS=Mus musculus OX=10090 GN=Vtcn1 PE=1 SV=1
4	Q8VE98	5.60e-16	80.5	316	0.169	0.222	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
5	Q5ZPR3	2.27e-15	80.1	534	0.203	0.157	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
6	Q6UX41	3.19e-08	57.8	500	0.118	0.098	BTNL8_HUMAN Butyrophilin-like protein 8 OS=Homo sapiens OX=9606 GN=BTNL8 PE=1 SV=1
7	A0A8J8XMF6	1.92e-07	54.7	297	0.133	0.185	A0A8J8XMF6_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
8	O35531	2.19e-07	54.7	313	0.133	0.176	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
9	P78410	8.75e-07	52.8	334	0.159	0.198	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
10	K4DIA0	1.30e-06	52.8	473	0.138	0.121	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
11	A0N0L8	1.49e-06	52.0	302	0.138	0.189	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1
12	O75144	1.49e-06	52.0	302	0.138	0.189	ICOSL_HUMAN ICOS ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=2
13	O00478	2.43e-06	52.0	584	0.155	0.110	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
14	O00481	6.97e-06	50.4	513	0.104	0.084	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
15	Q9UIR0	1.35e-05	49.7	455	0.174	0.158	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
16	Q9EP73	1.75e-05	48.5	290	0.116	0.166	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
17	P42082	2.14e-05	48.5	309	0.111	0.149	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
18	Q9NZQ7	2.96e-05	47.8	290	0.094	0.134	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
19	Q7TST0	3.21e-05	48.5	509	0.092	0.075	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
20	Q13410	3.79e-05	48.1	526	0.118	0.093	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.0006	31.5	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	3.3e+02	12.8	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	5e-07	41.0	Immunoglobulin I-set domain
4	PF00047 ig	8.4e-06	37.2	Immunoglobulin domain
5	PF13895 Ig_2	0.0002	32.9	Immunoglobulin domain
6	PF13927 Ig_3	3.3e-10	51.7	Immunoglobulin domain
7	PF07686 V-set	1.6e-25	100.8	Immunoglobulin V-set domain
8	PF08204 V-set_CD47	2.6	19.5	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301272	0.979	Transmembrane and immunoglobulin domain-containing protein 2
2	9606.ENSP00000359978	0.950	HERV-H LTR-associating 3
3	9606.ENSP00000232603	0.684	MORC family CW-type zinc finger protein 1
4	9606.ENSP00000355028	0.684	E3 ubiquitin-protein ligase DZIP3
5	9606.ENSP00000414109	0.667	Holliday junction recognition protein
6	9606.ENSP00000295746	0.632	Protein CIP2A
7	9606.ENSP00000320184	0.629	Mitochondrial ribosomal protein S23
8	9606.ENSP00000341637	0.617	Natural cytotoxicity triggering receptor 3 ligand 1
9	9606.ENSP00000365630	0.616	Ras and EF-hand domain-containing protein
10	9606.ENSP00000319476	0.600	Inducible T-cell costimulator
11	9606.ENSP00000264538	0.592	Intraflagellar transport protein 57 homolog
12	9606.ENSP00000273353	0.589	Myosin-15
13	9606.ENSP00000303939	0.582	Cytotoxic T-lymphocyte protein 4
14	9606.ENSP00000380855	0.539	Programmed cell death 1 ligand 2
15	9606.ENSP00000370989	0.537	Programmed cell death 1 ligand 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002682	0.997	regulation of immune system process
GO:0048522	0.995	positive regulation of cellular process
GO:0002684	0.993	positive regulation of immune system process
GO:0002694	0.993	regulation of leukocyte activation
GO:0051240	0.992	positive regulation of multicellular organismal process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0030155	0.968	regulation of cell adhesion
GO:0001817	0.963	regulation of cytokine production
GO:0051249	0.957	regulation of lymphocyte activation
GO:0070663	0.956	regulation of leukocyte proliferation
GO:0022407	0.955	regulation of cell-cell adhesion
GO:1903037	0.954	regulation of leukocyte cell-cell adhesion
GO:0050863	0.951	regulation of T cell activation
GO:0050670	0.948	regulation of lymphocyte proliferation
GO:0002696	0.946	positive regulation of leukocyte activation
GO:0070665	0.944	positive regulation of leukocyte proliferation
GO:0022409	0.943	positive regulation of cell-cell adhesion
GO:0042129	0.943	regulation of T cell proliferation
GO:0051251	0.942	positive regulation of lymphocyte activation
GO:0001819	0.941	positive regulation of cytokine production
GO:0042102	0.930	positive regulation of T cell proliferation
GO:0002376	0.903	immune system process
GO:0046006	0.896	regulation of activated T cell proliferation
GO:0009987	0.515	cellular process
GO:0050896	0.375	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.929	cell surface
GO:0005622	0.722	intracellular anatomical structure
GO:0005737	0.712	cytoplasm
GO:0043226	0.441	organelle
GO:0043227	0.396	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]