StarFunc result for job id Q9UM47

User Input

>input (2321 residues)
MGPGARGRRRRRRPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCDRNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCLESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYNGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCACPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFFRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSEPRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QZF2	0.197	0.188	0.000	2468	0.604	0.568	F1QZF2.pdb.gz
2	AFDB:O35516	0.181	0.172	0.000	2473	0.517	0.485	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
3	AFDB:P46530	0.135	0.130	0.000	2437	0.508	0.483	P46530.pdb.gz	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
4	AFDB:Q9UM47	0.999	0.999	0.000	2321	1.000	1.000	Q9UM47.pdb.gz	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
5	AFDB:A0A2R8QT22	0.068	0.111	1.426E-54	1216	0.126	0.241	A0A2R8QT22.pdb.gz
6	AFDB:Q9Y575	0.097	0.426	1.697E-14	518	0.028	0.127	Q9Y575.pdb.gz	ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens OX=9606 GN=ASB3 PE=1 SV=1
7	PDB:8cs9A	0.097	0.279	1.773E-14	796	0.034	0.098	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
8	AFDB:O15084	0.096	0.209	2.688E-14	1053	0.032	0.071	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
9	AFDB:A0A0R4IA11	0.094	0.379	1.692E-13	563	0.034	0.142	A0A0R4IA11.pdb.gz
10	AFDB:Q96Q27	0.089	0.345	4.244E-13	587	0.024	0.095	Q96Q27.pdb.gz	ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens OX=9606 GN=ASB2 PE=1 SV=2
11	AFDB:O75179	0.074	0.067	1.446E-12	2603	0.059	0.053	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
12	PDB:2dvwA	0.087	0.818	3.410E-11	229	0.026	0.266	2dvwA.pdb.gz
13	PDB:5vkqA	0.095	0.146	2.633E-10	1499	0.027	0.041	5vkqA.pdb.gz
14	PDB:1wg0A	0.090	0.783	9.939E-10	243	0.025	0.239	1wg0A.pdb.gz
15	PDB:4oauC	0.093	0.298	3.059E-9	692	0.029	0.097	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
16	PDB:6jd6B	0.064	0.734	9.873E-8	192	0.020	0.240	6jd6B.pdb.gz
17	PDB:6aunA	0.091	0.318	1.211E-7	618	0.028	0.105	6aunA.pdb.gz
18	PDB:6v9hC	0.092	0.722	1.211E-7	270	0.023	0.196	6v9hC.pdb.gz
19	PDB:6mwqA	0.058	0.246	2.125E-7	493	0.024	0.114	6mwqA.pdb.gz
20	PDB:6pqpA	0.073	0.259	1.207E-6	615	0.022	0.083	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0PGH6	2135	2465	0.495	0.466	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
2	A2RUV0	2117	2522	0.489	0.450	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
3	B8JI71	672	2904	0.186	0.149	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
4	F1RCH4	1963	2475	0.489	0.459	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
5	G3I6Z6	2219	2527	0.507	0.466	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
6	O35516	2185	2473	0.517	0.486	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
7	P07207	1732	2703	0.412	0.354	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
8	P21783	2117	2524	0.484	0.445	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
9	P31695	695	1964	0.186	0.220	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
10	P46530	2101	2437	0.508	0.484	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
11	P46531	2184	2555	0.506	0.460	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
12	Q01705	2216	2531	0.507	0.465	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
13	Q04721	2208	2471	0.517	0.486	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
14	Q07008	2212	2531	0.523	0.480	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
15	Q61982	4084	2318	0.893	0.894	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
16	Q800E4	2585	2468	0.582	0.547	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
17	Q99466	631	2003	0.205	0.237	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
18	Q9QW30	2183	2471	0.509	0.478	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
19	Q9R172	4082	2319	0.895	0.896	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2
20	Q9UM47	4610	2321	1.000	1.000	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.5e-23	93.4	Ankyrin repeat
2	PF12796 Ank_2	8.8e-22	88.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.9e-15	66.2	Ankyrin repeat
4	PF13637 Ank_4	2.2e-15	68.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.9e-18	77.5	Ankyrin repeats (many copies)
6	PF12662 cEGF	0.0012	30.0	Complement Clr-like EGF-like
7	PF00008 EGF	1.1e-176	583.6	EGF-like domain
8	PF07974 EGF_2	7.8e-27	104.6	EGF-like domain
9	PF12947 EGF_3	7.3e-10	50.2	EGF domain
10	PF07645 EGF_CA	4.1e-58	204.7	Calcium-binding EGF domain
11	PF14670 FXa_inhibition	3.2e+02	13.1	Coagulation Factor Xa inhibitory site
12	PF12661 hEGF	2.6e-107	359.5	Human growth factor-like EGF
13	PF06816 NOD	3.5e-17	72.8	NOTCH protein
14	PF07684 NODP	1.6e-19	81.0	NOTCH protein
15	PF00066 Notch	5.3e-24	95.7	LNR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263388

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.998	Recombining binding protein suppressor of hairless
2	9606.ENSP00000338272	0.986	Hairy/enhancer-of-split related with YRPW motif protein 1
3	9606.ENSP00000254958	0.984	Protein jagged-1
4	9606.ENSP00000355747	0.979	Presenilin-2
5	9606.ENSP00000477815	0.978	Pre T-cell antigen receptor alpha
6	9606.ENSP00000355718	0.975	Delta-like protein 1
7	9606.ENSP00000357348	0.975	Hairy/enhancer-of-split related with YRPW motif protein 2
8	9606.ENSP00000361626	0.975	Nuclease-sensitive element-binding protein 1
9	9606.ENSP00000326366	0.973	Presenilin-1
10	9606.ENSP00000260408	0.969	Disintegrin and metalloproteinase domain-containing protein 10
11	9606.ENSP00000361943	0.969	Hairy/enhancer-of-split related with YRPW motif-like protein
12	9606.ENSP00000367714	0.969	Transcription factor HES-5
13	9606.ENSP00000222725	0.966	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
14	9606.ENSP00000328169	0.965	Protein jagged-2
15	9606.ENSP00000232424	0.962	Transcription factor HES-1
16	9606.ENSP00000294785	0.962	Nicastrin
17	9606.ENSP00000349490	0.958	Beta-1,3-N-acetylglucosaminyltransferase manic fringe
18	9606.ENSP00000307971	0.957	Beta-1,3-N-acetylglucosaminyltransferase radical fringe
19	9606.ENSP00000249749	0.956	Delta-like protein 4
20	9606.ENSP00000364902	0.956	GDP-fucose protein O-fucosyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	0.999	signaling receptor activity
GO:0042802	0.998	identical protein binding
GO:0050839	0.992	cell adhesion molecule binding
GO:0045296	0.940	cadherin binding
GO:0019899	0.866	enzyme binding
GO:0004888	0.345	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0032502	0.986	developmental process
GO:0032501	0.985	multicellular organismal process
GO:0051716	0.983	cellular response to stimulus
GO:0048856	0.980	anatomical structure development
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0080090	0.970	regulation of primary metabolic process
GO:0007275	0.961	multicellular organism development
GO:0007165	0.960	signal transduction
GO:0009889	0.956	regulation of biosynthetic process
GO:0007219	0.954	Notch signaling pathway
GO:0048518	0.937	positive regulation of biological process
GO:0031326	0.934	regulation of cellular biosynthetic process
GO:0010556	0.932	regulation of macromolecule biosynthetic process
GO:0048731	0.906	system development
GO:0048519	0.879	negative regulation of biological process
GO:0019219	0.874	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.872	negative regulation of cellular process
GO:0048869	0.865	cellular developmental process
GO:0030154	0.859	cell differentiation
GO:0048522	0.853	positive regulation of cellular process
GO:0051252	0.851	regulation of RNA metabolic process
GO:2001141	0.844	regulation of RNA biosynthetic process
GO:0010604	0.829	positive regulation of macromolecule metabolic process
GO:1903506	0.799	regulation of nucleic acid-templated transcription
GO:0048513	0.797	animal organ development
GO:0006355	0.791	regulation of DNA-templated transcription
GO:0051173	0.766	positive regulation of nitrogen compound metabolic process
GO:0009892	0.743	negative regulation of metabolic process
GO:0009653	0.627	anatomical structure morphogenesis
GO:0051239	0.621	regulation of multicellular organismal process
GO:0050793	0.619	regulation of developmental process
GO:0051172	0.599	negative regulation of nitrogen compound metabolic process
GO:0031325	0.572	positive regulation of cellular metabolic process
GO:0010605	0.534	negative regulation of macromolecule metabolic process
GO:0010557	0.525	positive regulation of macromolecule biosynthetic process
GO:0045935	0.505	positive regulation of nucleobase-containing compound metabolic process
GO:0031324	0.503	negative regulation of cellular metabolic process
GO:0051254	0.501	positive regulation of RNA metabolic process
GO:0006357	0.474	regulation of transcription by RNA polymerase II
GO:0031328	0.455	positive regulation of cellular biosynthetic process
GO:0045893	0.447	positive regulation of DNA-templated transcription
GO:0007399	0.417	nervous system development
GO:0048583	0.414	regulation of response to stimulus
GO:0006950	0.410	response to stress
GO:0009966	0.397	regulation of signal transduction
GO:0045595	0.364	regulation of cell differentiation
GO:0009888	0.337	tissue development
GO:0042127	0.334	regulation of cell population proliferation
GO:0009890	0.322	negative regulation of biosynthetic process
GO:0031327	0.313	negative regulation of cellular biosynthetic process
GO:0045165	0.305	cell fate commitment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0005654	0.996	nucleoplasm
GO:0012505	0.988	endomembrane system
GO:0005576	0.942	extracellular region
GO:0032991	0.905	protein-containing complex
GO:0043232	0.697	intracellular non-membrane-bounded organelle
GO:0005783	0.687	endoplasmic reticulum
GO:0031090	0.601	organelle membrane
GO:0098588	0.568	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]