StarFunc result for job id Q9UM54

User Input

>input (1294 residues)
MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVE
DNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSL
GTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDD
RIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGK
EERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEY
LKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSG
GCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNAR
DALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKL
QQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSD
QHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDA
LHMSLESLICESRDKFIRELFESSTNNNKDTKQKAGKLSFISVGNKFKTQLNLLLDKLRS
TGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKK
YMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAEL
VKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGL
VKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYD
ALVKSSEELLSALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEM
EAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSE
AELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAG
TKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAP
KSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKG
WWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEE
IWERCGGIQYLQNAIESRQARPTYATAMLQSLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4anjA	0.586	0.759	0.000	995	0.582	0.757	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
2	AFDB:E7FGA0	0.558	0.569	0.000	1267	0.814	0.831	E7FGA0.pdb.gz
3	AFDB:E9QCU8	0.589	0.592	0.000	1288	0.810	0.814	E9QCU8.pdb.gz
4	AFDB:F1Q6Q6	0.592	0.611	0.000	1253	0.801	0.827	F1Q6Q6.pdb.gz	F1Q6Q6_DANRE Unconventional myosin-VI OS=Danio rerio OX=7955 GN=myo6a PE=1 SV=1
5	AFDB:Q01989	0.578	0.597	0.000	1253	0.505	0.522	Q01989.pdb.gz	MYS9_DROME Myosin heavy chain 95F OS=Drosophila melanogaster OX=7227 GN=jar PE=2 SV=4
6	AFDB:Q64331	0.586	0.599	0.000	1265	0.890	0.911	Q64331.pdb.gz	MYO6_MOUSE Unconventional myosin-VI OS=Mus musculus OX=10090 GN=Myo6 PE=1 SV=2
7	AFDB:Q9TZI9	0.635	0.672	0.000	1219	0.451	0.478	Q9TZI9.pdb.gz	Q9TZI9_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spe-15 PE=1 SV=1
8	AFDB:Q9UM54	1.000	1.000	0.000	1294	1.000	1.000	Q9UM54.pdb.gz	MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=4
9	AFDB:F4K5J1	0.491	0.417	2.330E-70	1531	0.282	0.238	F4K5J1.pdb.gz	MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana OX=3702 GN=XI-K PE=1 SV=2
10	AFDB:F4IUG9	0.492	0.428	5.922E-70	1493	0.280	0.242	F4IUG9.pdb.gz	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
11	AFDB:Q9LKB9	0.496	0.428	1.577E-69	1505	0.289	0.249	Q9LKB9.pdb.gz	MYO6_ARATH Myosin-6 OS=Arabidopsis thaliana OX=3702 GN=XI-2 PE=1 SV=1
12	PDB:4pa0A	0.461	0.603	1.582E-54	974	0.202	0.268	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.461	0.637	3.040E-54	920	0.199	0.280	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.515	0.798	9.756E-54	817	0.190	0.301	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.459	0.615	3.079E-52	952	0.198	0.269	4p7hB.pdb.gz
16	PDB:7mf3B	0.507	0.716	2.241E-47	896	0.238	0.344	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.471	0.625	7.863E-44	954	0.221	0.300	5tbyA.pdb.gz
18	PDB:7nkxZ	0.037	0.275	3.304E-1	156	0.009	0.071	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:7m8eF	0.045	0.058	5.520E-1	967	0.019	0.026	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
20	PDB:6tedZ	0.037	0.090	5.783E-1	510	0.009	0.022	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRM8	2585	1253	0.968	0.999	A0A0A0MRM8_HUMAN Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=1
2	A0A0D9SGC1	1994	962	0.741	0.997	A0A0D9SGC1_HUMAN Myosin VI (Fragment) OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=2
3	A0A1Y0BRN3	2658	1285	0.991	0.998	A0A1Y0BRN3_HUMAN Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=1
4	A0A590UJ40	2687	1294	0.999	0.999	A0A590UJ40_HUMAN Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=1
5	A0A590UJ75	1937	926	0.716	1.000	A0A590UJ75_HUMAN Myosin VI (Fragment) OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=1
6	A0A590UK22	1843	878	0.679	1.000	A0A590UK22_HUMAN Myosin VI (Fragment) OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=1
7	A0A590UKB0	1934	924	0.714	1.000	A0A590UKB0_HUMAN Myosin VI (Fragment) OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=1
8	A0A8I5Y7N7	2435	1274	0.945	0.960	A0A8I5Y7N7_RAT Unconventional myosin-VI OS=Rattus norvegicus OX=10116 GN=Myo6 PE=1 SV=1
9	A0A8I5ZWC2	2509	1253	0.936	0.966	A0A8I5ZWC2_RAT Unconventional myosin-VI OS=Rattus norvegicus OX=10116 GN=Myo6 PE=1 SV=1
10	A0A8I5ZYN7	2588	1285	0.957	0.964	A0A8I5ZYN7_RAT Unconventional myosin-VI OS=Rattus norvegicus OX=10116 GN=Myo6 PE=1 SV=1
11	A0A8I6ACM8	2493	1294	0.959	0.959	A0A8I6ACM8_RAT Unconventional myosin-VI OS=Rattus norvegicus OX=10116 GN=Myo6 PE=1 SV=1
12	A0A8I6AEW8	2466	1284	0.954	0.961	A0A8I6AEW8_RAT Unconventional myosin-VI OS=Rattus norvegicus OX=10116 GN=Myo6 PE=1 SV=1
13	D4A5I9	2462	1285	0.951	0.958	D4A5I9_RAT Unconventional myosin-VI OS=Rattus norvegicus OX=10116 GN=Myo6 PE=1 SV=3
14	E9QFU5	2166	1252	0.818	0.846	E9QFU5_DANRE Unconventional myosin-VI OS=Danio rerio OX=7955 GN=myo6b PE=1 SV=3
15	F1Q6Q6	2063	1253	0.803	0.829	F1Q6Q6_DANRE Unconventional myosin-VI OS=Danio rerio OX=7955 GN=myo6a PE=1 SV=1
16	F1R4R9	2160	1255	0.818	0.844	F1R4R9_DANRE Unconventional myosin-VI OS=Danio rerio OX=7955 GN=myo6b PE=1 SV=1
17	Q01989	1285	1253	0.512	0.529	MYS9_DROME Myosin heavy chain 95F OS=Drosophila melanogaster OX=7227 GN=jar PE=2 SV=4
18	Q29122	2503	1254	0.936	0.966	MYO6_PIG Unconventional myosin-VI OS=Sus scrofa OX=9823 GN=MYO6 PE=1 SV=1
19	Q64331	2543	1262	0.944	0.968	MYO6_MOUSE Unconventional myosin-VI OS=Mus musculus OX=10090 GN=Myo6 PE=1 SV=2
20	Q68RJ3	2152	1267	0.818	0.835	Q68RJ3_DANRE Unconventional myosin-VI OS=Danio rerio OX=7955 GN=myo6b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09073 BUD22	0.54	21.2	BUD22
2	PF00612 IQ	20	16.3	IQ calmodulin-binding motif
3	PF09726 Macoilin	6.2e+02	10.3	Macoilin family
4	PF16521 Myosin-VI_CBD	2e-41	151.2	Myosin VI cargo binding domain
5	PF00063 Myosin_head	1.3e-236	798.7	Myosin head (motor domain)
6	PF02736 Myosin_N	1.9	19.6	Myosin N-terminal SH3-like domain
7	PF10779 XhlA	32	16.1	Haemolysin XhlA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000042221

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000018074	0.948	GIPC PDZ domain containing family, member 1
2	9598.ENSPTRP00000028835	0.948	Dab, mitogen-responsive phosphoprotein, homolog 2 (Drosophila)
3	9598.ENSPTRP00000024621	0.896	Uncharacterized protein
4	9598.ENSPTRP00000039324	0.880	Clathrin heavy chain
5	9598.ENSPTRP00000007058	0.845	P21 (RAC1) activated kinase 1
6	9598.ENSPTRP00000041645	0.844	Serine/threonine-protein kinase PAK 3
7	9598.ENSPTRP00000001540	0.829	Uncharacterized protein
8	9598.ENSPTRP00000017453	0.824	GIPC PDZ domain containing family, member 3
9	9598.ENSPTRP00000050925	0.823	Polyubiquitin-C
10	9598.ENSPTRP00000055212	0.823	annotation not available
11	9598.ENSPTRP00000027175	0.785	Discs, large homolog 1
12	9598.ENSPTRP00000048097	0.777	Tax1 binding protein 1
13	9598.ENSPTRP00000040385	0.762	Uncharacterized protein
14	9598.ENSPTRP00000044466	0.748	Catenin (Cadherin-associated protein), beta 1, 88kDa
15	9598.ENSPTRP00000029795	0.739	Glutamate receptor, ionotropic, AMPA 1
16	9598.ENSPTRP00000035797	0.729	Clathrin light chain
17	9598.ENSPTRP00000004598	0.720	Vinculin
18	9598.ENSPTRP00000007287	0.719	Glutamate receptor, ionotropic, AMPA 4
19	9598.ENSPTRP00000014780	0.715	Uncharacterized protein
20	9598.ENSPTRP00000024207	0.712	Clathrin heavy chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008092	0.662	cytoskeletal protein binding
GO:0003779	0.563	actin binding
GO:0003774	0.404	cytoskeletal motor activity
GO:0042802	0.367	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.972	response to stimulus
GO:0009987	0.968	cellular process
GO:0009410	0.941	response to xenobiotic stimulus
GO:0065007	0.557	biological regulation
GO:0050789	0.538	regulation of biological process
GO:0032501	0.517	multicellular organismal process
GO:0050794	0.452	regulation of cellular process
GO:0051179	0.443	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0071944	0.995	cell periphery
GO:0031982	0.992	vesicle
GO:0120025	0.990	plasma membrane bounded cell projection
GO:0005654	0.986	nucleoplasm
GO:0016020	0.981	membrane
GO:0032991	0.970	protein-containing complex
GO:0005886	0.965	plasma membrane
GO:0031410	0.934	cytoplasmic vesicle
GO:0005829	0.918	cytosol
GO:0030139	0.852	endocytic vesicle
GO:0043232	0.802	intracellular non-membrane-bounded organelle
GO:0001726	0.777	ruffle
GO:0005856	0.675	cytoskeleton
GO:0015629	0.627	actin cytoskeleton
GO:0098858	0.422	actin-based cell projection
GO:0098590	0.405	plasma membrane region
GO:0005794	0.398	Golgi apparatus
GO:0031253	0.344	cell projection membrane
GO:0045177	0.332	apical part of cell
GO:0099081	0.330	supramolecular polymer
GO:0099512	0.324	supramolecular fiber
GO:0005902	0.311	microvillus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]