StarFunc result for job id Q9UM63

User Input

>input (463 residues)
MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK
SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL
TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG
CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP
PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN
HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN
LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ
QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UM63	1.000	1.000	7.403E-74	463	1.000	1.000	Q9UM63.pdb.gz	PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens OX=9606 GN=PLAGL1 PE=1 SV=2
2	AFDB:A0A024R7Z0	0.385	0.360	1.047E-34	500	0.460	0.426	A0A024R7Z0.pdb.gz
3	AFDB:Q6ZQG6	0.367	0.339	1.687E-33	506	0.462	0.423	Q6ZQG6.pdb.gz	Q6ZQG6_MOUSE MKIAA0198 protein (Fragment) OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
4	AFDB:Q9N360	0.166	0.120	3.157E-15	662	0.212	0.148	Q9N360.pdb.gz	Q9N360_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=znf-782 PE=1 SV=1
5	AFDB:Q9H4Z2	0.298	0.122	1.117E-14	1342	0.242	0.083	Q9H4Z2.pdb.gz	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1
6	AFDB:Q9HAZ2	0.327	0.132	2.881E-14	1276	0.201	0.073	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
7	AFDB:B8A5T9	0.254	0.140	2.629E-13	927	0.214	0.107	B8A5T9.pdb.gz
8	AFDB:Q2EI20	0.270	0.165	5.977E-13	855	0.181	0.098	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
9	AFDB:O54963	0.274	0.135	1.321E-11	1069	0.194	0.084	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
10	AFDB:Q13127	0.255	0.128	4.672E-11	1097	0.184	0.077	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
11	PDB:3w5kB	0.098	0.251	2.110E-4	110	0.076	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6qw6S	0.069	0.181	3.644E-1	126	0.050	0.183	6qw6S.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:5apny	0.069	0.124	1.660	211	0.060	0.133	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
14	PDB:7a5hC	0.072	0.202	2.752	114	0.028	0.114	7a5hC.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
15	PDB:7w3ax	0.072	0.069	3.122	494	0.050	0.047	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	PDB:6mzcK	0.063	0.130	3.326	202	0.056	0.129	6mzcK.pdb.gz
17	PDB:7uhyC	0.050	0.042	3.326	578	0.030	0.024	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:5gm6a	0.042	0.132	3.543	123	0.032	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5xbtA	0.070	0.111	3.543	271	0.041	0.070	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
20	PDB:4n78F	0.062	0.123	4.020	156	0.039	0.115	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UM63	0.0	943	463	1.000	1.000	PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens OX=9606 GN=PLAGL1 PE=1 SV=2
2	Q68DN7	8.52e-177	496	252	0.544	1.000	Q68DN7_HUMAN Uncharacterized protein DKFZp781P1017 OS=Homo sapiens OX=9606 GN=DKFZp781P1017 PE=2 SV=1
3	Q9EPT3	2.88e-154	455	675	0.458	0.314	Q9EPT3_MOUSE Lost on transformation protein 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
4	O35745	3.12e-154	455	667	0.458	0.318	O35745_MOUSE Zinc finger protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
5	Q3UQW2	4.27e-154	455	678	0.458	0.313	Q3UQW2_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
6	B7ZP38	4.36e-154	455	678	0.458	0.313	B7ZP38_MOUSE Plagl1 protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
7	Q3UQR2	4.41e-154	455	678	0.458	0.313	Q3UQR2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
8	Q9JLQ4	1.19e-153	454	704	0.458	0.301	Q9JLQ4_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
9	Q6DJT9	2.75e-113	344	500	0.479	0.444	PLAG1_HUMAN Zinc finger protein PLAG1 OS=Homo sapiens OX=9606 GN=PLAG1 PE=1 SV=1
10	Q9QYE0	1.64e-110	337	499	0.352	0.327	PLAG1_MOUSE Zinc finger protein PLAG1 OS=Mus musculus OX=10090 GN=Plag1 PE=2 SV=2
11	Q3UZI7	7.69e-106	325	496	0.456	0.425	Q3UZI7_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
12	Q9UPG8	4.60e-105	323	496	0.454	0.423	PLAL2_HUMAN Zinc finger protein PLAGL2 OS=Homo sapiens OX=9606 GN=PLAGL2 PE=1 SV=1
13	Q925T4	1.00e-104	322	496	0.454	0.423	Q925T4_MOUSE PLAGL2 OS=Mus musculus OX=10090 GN=Plagl2 PE=1 SV=1
14	Q6ZQG6	1.07e-104	322	506	0.454	0.415	Q6ZQG6_MOUSE MKIAA0198 protein (Fragment) OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
15	Q9QZJ1	1.24e-88	278	408	0.404	0.458	Q9QZJ1_MOUSE Pleomorphic adenoma gene like 2 OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
16	A0A0A6YWE3	2.12e-70	221	121	0.214	0.818	A0A0A6YWE3_MOUSE Pleiomorphic adenoma gene-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Plagl1 PE=4 SV=1
17	B0QZX4	4.21e-67	212	117	0.205	0.812	B0QZX4_MOUSE Pleiomorphic adenoma gene-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Plagl1 PE=4 SV=1
18	Q8CFT9	4.26e-48	166	198	0.175	0.409	Q8CFT9_MOUSE Plagl2 protein OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
19	Q80X44	1.13e-30	127	710	0.192	0.125	ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus OX=10090 GN=Zbtb24 PE=1 SV=1
20	M9PD94	1.76e-29	124	907	0.145	0.074	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16076 Acyltransf_C	44	15.4	Acyltransferase C-terminus
2	PF00096 zf-C2H2	4.1e-13	60.1	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	3.5e-14	63.3	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	70	14.9	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	86	14.9	C2H2-type zinc ribbon
6	PF12171 zf-C2H2_jaz	20	16.9	Zinc-finger double-stranded RNA-binding
7	PF13465 zf-H2C2_2	6.1e-10	50.3	Zinc-finger double domain
8	PF12874 zf-met	14	17.5	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353734

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.969	Cellular tumor antigen p53
2	9606.ENSP00000223215	0.766	Mesoderm-specific transcript homolog protein
3	9606.ENSP00000326581	0.744	Paternally-expressed gene 3 protein
4	9606.ENSP00000418944	0.744	Retrotransposon-derived protein PEG10
5	9606.ENSP00000360020	0.739	GTP-binding protein Di-Ras3
6	9606.ENSP00000462647	0.725	Pituitary adenylate cyclase-activating polypeptide
7	9606.ENSP00000382972	0.705	Small nuclear ribonucleoprotein-associated protein N
8	9606.ENSP00000381793	0.693	Growth factor receptor-bound protein 10
9	9606.ENSP00000062104	0.690	Neuronatin
10	9606.ENSP00000320488	0.675	Nucleosome assembly protein 1 like 5
11	9606.ENSP00000398930	0.674	Epsilon-sarcoglycan
12	9606.ENSP00000391826	0.669	Insulin-like growth factor II
13	9606.ENSP00000340292	0.666	Protein delta homolog 1
14	9606.ENSP00000319231	0.660	Pleckstrin homology-like domain family A member 2
15	9606.ENSP00000369948	0.644	Solute carrier family 22 member 18
16	9606.ENSP00000332208	0.643	DNA-binding protein RFX6
17	9606.ENSP00000383143	0.623	SLIT and NTRK-like protein 6
18	9606.ENSP00000332643	0.614	Necdin
19	9606.ENSP00000360141	0.609	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
20	9606.ENSP00000349437	0.595	Cation-independent mannose-6-phosphate receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0010468	0.991	regulation of gene expression
GO:0010556	0.906	regulation of macromolecule biosynthetic process
GO:0006355	0.900	regulation of DNA-templated transcription
GO:0031325	0.833	positive regulation of cellular metabolic process
GO:0010604	0.828	positive regulation of macromolecule metabolic process
GO:0051173	0.827	positive regulation of nitrogen compound metabolic process
GO:0045935	0.747	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.699	positive regulation of RNA metabolic process
GO:0010557	0.684	positive regulation of macromolecule biosynthetic process
GO:0006357	0.665	regulation of transcription by RNA polymerase II
GO:0045893	0.661	positive regulation of DNA-templated transcription
GO:0008219	0.651	cell death
GO:0051726	0.643	regulation of cell cycle
GO:0045944	0.504	positive regulation of transcription by RNA polymerase II
GO:0012501	0.477	programmed cell death
GO:0032502	0.430	developmental process
GO:0006915	0.424	apoptotic process
GO:0048856	0.404	anatomical structure development
GO:0032501	0.342	multicellular organismal process
GO:0008152	0.316	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0012505	0.991	endomembrane system
GO:0005737	0.988	cytoplasm
GO:0016604	0.537	nuclear body
GO:0005794	0.486	Golgi apparatus
GO:0005829	0.410	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]