StarFunc result for job id Q9UM73

User Input

>input (1620 residues)
MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDY
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQ
MDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYC
NFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP
APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPL
LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP
NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPN
DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAA
PPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPT
SLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPS
SLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97793	0.663	0.663	0.000	1621	0.874	0.874	P97793.pdb.gz	ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Alk PE=1 SV=2
2	AFDB:Q9UM73	0.999	0.999	0.000	1620	1.000	1.000	Q9UM73.pdb.gz	ALK_HUMAN ALK tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3
3	AFDB:P29376	0.407	0.736	2.696E-98	864	0.281	0.527	P29376.pdb.gz	LTK_HUMAN Leukocyte tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=LTK PE=1 SV=3
4	AFDB:P08923	0.391	0.668	6.605E-97	888	0.277	0.505	P08923.pdb.gz	LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Ltk PE=1 SV=3
5	AFDB:A0A0R4IRF5	0.198	0.480	1.774E-55	651	0.233	0.579	A0A0R4IRF5.pdb.gz
6	AFDB:F1QNX5	0.187	0.222	1.964E-28	1353	0.125	0.150	F1QNX5.pdb.gz
7	AFDB:A0A0R4IGP2	0.167	0.187	5.234E-28	1433	0.131	0.149	A0A0R4IGP2.pdb.gz
8	AFDB:Q64716	0.170	0.210	2.219E-27	1300	0.132	0.165	Q64716.pdb.gz	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
9	AFDB:Q1LVG4	0.170	0.200	3.184E-27	1348	0.125	0.151	Q1LVG4.pdb.gz	Q1LVG4_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=IRb PE=1 SV=3
10	AFDB:Q90413	0.170	0.295	1.422E-26	922	0.116	0.204	Q90413.pdb.gz	FGFR4_DANRE Fibroblast growth factor receptor 4 OS=Danio rerio OX=7955 GN=fgfr4 PE=1 SV=1
11	PDB:1k9aB	0.148	0.528	1.513E-20	441	0.061	0.224	1k9aB.pdb.gz
12	PDB:4k2rA	0.153	0.432	1.624E-19	551	0.056	0.165	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:2h8hA	0.153	0.521	1.800E-19	445	0.064	0.234	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:4fl2A	0.155	0.430	3.903E-19	555	0.062	0.180	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:8dksA	0.135	0.691	6.044E-15	283	0.046	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6pjxA	0.147	0.412	1.530E-14	543	0.044	0.133	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
17	PDB:6s73A	0.146	0.788	1.530E-14	269	0.036	0.219	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:2qkwB	0.142	0.693	3.492E-14	292	0.043	0.236	2qkwB.pdb.gz
19	PDB:2yaaA	0.159	0.770	5.012E-14	300	0.035	0.187	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
20	PDB:4krcA	0.145	0.719	6.830E-14	297	0.037	0.202	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LRZ0	0.0	2722	1617	0.883	0.884	F1LRZ0_RAT Tyrosine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Alk PE=3 SV=4
2	F1QVU0	0.0	1049	1530	0.415	0.439	LTK_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ltk PE=1 SV=1
3	F8W3R9	0.0	1195	1705	0.458	0.435	ALK_DANRE ALK tyrosine kinase receptor OS=Danio rerio OX=7955 GN=alk PE=2 SV=2
4	P08923	0.0	719	888	0.278	0.507	LTK_MOUSE Leukocyte tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Ltk PE=1 SV=3
5	P29376	0.0	770	864	0.287	0.538	LTK_HUMAN Leukocyte tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=LTK PE=1 SV=3
6	P97793	0.0	2668	1621	0.878	0.877	ALK_MOUSE ALK tyrosine kinase receptor OS=Mus musculus OX=10090 GN=Alk PE=1 SV=2
7	Q8CJH1	0.0	716	351	0.212	0.977	Q8CJH1_RAT Tyrosine-protein kinase receptor (Fragment) OS=Rattus norvegicus OX=10116 GN=Alk PE=2 SV=1
8	Q9UM73	0.0	3340	1620	1.000	1.000	ALK_HUMAN ALK tyrosine kinase receptor OS=Homo sapiens OX=9606 GN=ALK PE=1 SV=3
9	Q7KJ08	1.82e-162	539	1701	0.262	0.249	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
10	Q8SWV4	6.44e-140	464	1158	0.212	0.296	Q8SWV4_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
11	O76411	2.53e-85	310	1421	0.198	0.225	SCD2_CAEEL ALK tyrosine kinase receptor homolog scd-2 OS=Caenorhabditis elegans OX=6239 GN=scd-2 PE=1 SV=3
12	Q78DX7	1.87e-81	300	2340	0.114	0.079	ROS1_MOUSE Proto-oncogene tyrosine-protein kinase ROS OS=Mus musculus OX=10090 GN=Ros1 PE=1 SV=1
13	P08922	5.62e-81	299	2347	0.107	0.074	ROS1_HUMAN Proto-oncogene tyrosine-protein kinase ROS OS=Homo sapiens OX=9606 GN=ROS1 PE=1 SV=3
14	Q05688	2.33e-79	278	640	0.089	0.225	IGF1R_BOVIN Insulin-like growth factor 1 receptor (Fragment) OS=Bos taurus OX=9913 GN=IGF1R PE=2 SV=1
15	Q64716	2.75e-75	278	1300	0.085	0.106	INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus OX=10116 GN=Insrr PE=1 SV=3
16	Q9WTL4	3.55e-75	278	1300	0.085	0.106	INSRR_MOUSE Insulin receptor-related protein OS=Mus musculus OX=10090 GN=Insrr PE=1 SV=2
17	O73798	4.64e-75	278	1358	0.089	0.106	IGF1R_XENLA Insulin-like growth factor 1 receptor OS=Xenopus laevis OX=8355 GN=igf1r PE=1 SV=1
18	G1K218	8.94e-75	277	1367	0.089	0.105	G1K218_BOVIN Tyrosine-protein kinase receptor OS=Bos taurus OX=9913 GN=IGF1R PE=3 SV=3
19	Q60751	1.20e-74	276	1373	0.091	0.108	IGF1R_MOUSE Insulin-like growth factor 1 receptor OS=Mus musculus OX=10090 GN=Igf1r PE=1 SV=3
20	P08069	1.34e-74	276	1367	0.090	0.106	IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens OX=9606 GN=IGF1R PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12810 Gly_rich	2.9e-11	55.3	Glycine rich protein
2	PF00057 Ldl_recept_a	71	15.0	Low-density lipoprotein receptor domain class A
3	PF00629 MAM	5.2e-26	102.8	MAM domain, meprin/A5/mu
4	PF00069 Pkinase	8.5e-29	112.3	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	4e-85	296.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373700

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320663	0.998	Echinoderm microtubule-associated protein-like 4
2	9606.ENSP00000341170	0.993	Pleiotrophin
3	9606.ENSP00000296930	0.991	Nucleophosmin
4	9606.ENSP00000385451	0.990	Midkine
5	9606.ENSP00000376345	0.982	Growth factor receptor-bound protein 2
6	9606.ENSP00000244007	0.979	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
7	9606.ENSP00000256078	0.978	GTPase KRas
8	9606.ENSP00000407586	0.976	GTPase HRas
9	9606.ENSP00000384604	0.974	ALK and LTK ligand 2
10	9606.ENSP00000263967	0.954	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
11	9606.ENSP00000357516	0.933	Tropomyosin alpha-3 chain
12	9606.ENSP00000358548	0.926	GTPase NRas
13	9606.ENSP00000391676	0.922	Tyrosine-protein kinase JAK3
14	9606.ENSP00000364995	0.906	SHC-transforming protein 3
15	9606.ENSP00000289153	0.890	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
16	9606.ENSP00000371067	0.889	Tyrosine-protein kinase JAK2
17	9606.ENSP00000263932	0.872	Tumor necrosis factor receptor superfamily member 8
18	9606.ENSP00000335153	0.871	Heat shock protein HSP 90-alpha
19	9606.ENSP00000351345	0.866	ALK and LTK ligand 1
20	9606.ENSP00000377047	0.863	Receptor-type tyrosine-protein phosphatase zeta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0019199	0.975	transmembrane receptor protein kinase activity
GO:0004714	0.974	transmembrane receptor protein tyrosine kinase activity
GO:0042802	0.926	identical protein binding
GO:0098772	0.758	molecular function regulator activity
GO:0140677	0.730	molecular function activator activity
GO:0097367	0.728	carbohydrate derivative binding
GO:0030234	0.727	enzyme regulator activity
GO:0019887	0.715	protein kinase regulator activity
GO:0008047	0.706	enzyme activator activity
GO:0030295	0.693	protein kinase activator activity
GO:0030296	0.683	protein tyrosine kinase activator activity
GO:0008201	0.668	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.986	response to stimulus
GO:0032501	0.969	multicellular organismal process
GO:0048856	0.968	anatomical structure development
GO:0019222	0.948	regulation of metabolic process
GO:0080090	0.936	regulation of primary metabolic process
GO:0007275	0.914	multicellular organism development
GO:0048518	0.888	positive regulation of biological process
GO:0048731	0.871	system development
GO:0048522	0.869	positive regulation of cellular process
GO:0051716	0.861	cellular response to stimulus
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0071704	0.830	organic substance metabolic process
GO:0031323	0.823	regulation of cellular metabolic process
GO:0010556	0.822	regulation of macromolecule biosynthetic process
GO:0031326	0.814	regulation of cellular biosynthetic process
GO:0044238	0.805	primary metabolic process
GO:0044237	0.803	cellular metabolic process
GO:0010468	0.802	regulation of gene expression
GO:0023052	0.793	signaling
GO:0007154	0.792	cell communication
GO:0006355	0.775	regulation of DNA-templated transcription
GO:0065009	0.759	regulation of molecular function
GO:0006807	0.747	nitrogen compound metabolic process
GO:0007165	0.746	signal transduction
GO:0043170	0.729	macromolecule metabolic process
GO:0016310	0.726	phosphorylation
GO:0048523	0.715	negative regulation of cellular process
GO:0007399	0.705	nervous system development
GO:0048583	0.700	regulation of response to stimulus
GO:0030154	0.692	cell differentiation
GO:1901564	0.667	organonitrogen compound metabolic process
GO:0019538	0.642	protein metabolic process
GO:0036211	0.617	protein modification process
GO:0044093	0.601	positive regulation of molecular function
GO:0022008	0.552	neurogenesis
GO:0010646	0.506	regulation of cell communication
GO:0023051	0.501	regulation of signaling
GO:0009966	0.456	regulation of signal transduction
GO:0006468	0.407	protein phosphorylation
GO:0010941	0.401	regulation of cell death
GO:0042981	0.392	regulation of apoptotic process
GO:0009893	0.381	positive regulation of metabolic process
GO:0009892	0.355	negative regulation of metabolic process
GO:0051128	0.324	regulation of cellular component organization
GO:0042221	0.318	response to chemical
GO:0007166	0.309	cell surface receptor signaling pathway
GO:0050793	0.307	regulation of developmental process
GO:0051239	0.306	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	1.000	vesicle
GO:0005886	0.999	plasma membrane
GO:0005576	0.998	extracellular region
GO:0032991	0.994	protein-containing complex
GO:0070062	0.989	extracellular exosome
GO:0005622	0.979	intracellular anatomical structure
GO:0005737	0.968	cytoplasm
GO:0043229	0.966	intracellular organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0012505	0.484	endomembrane system
GO:0005829	0.437	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.974	receptor protein-tyrosine kinase.

[back to server]