StarFunc result for job id Q9UMR3

User Input

>input (447 residues)
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTS
LDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEM
IITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLP
ARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHT
ASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESV
ESLIQKHSYARSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSLSSWVSSSSSFPGFQ
HPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPR
YHHYFQQGPYAAIQGLRHSSAVMTPFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UMR3	0.999	0.999	3.697E-79	447	1.000	1.000	Q9UMR3.pdb.gz	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
2	AFDB:Q9I9K7	0.577	0.578	1.434E-69	446	0.866	0.868	Q9I9K7.pdb.gz	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
3	AFDB:Q9VMR2	0.436	0.339	1.413E-36	580	0.418	0.322	Q9VMR2.pdb.gz	Q9VMR2_DROME LP04777p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
4	AFDB:O62535	0.427	0.270	4.915E-36	712	0.365	0.229	O62535.pdb.gz	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
5	AFDB:Q9Y458	0.420	0.362	1.730E-34	520	0.365	0.313	Q9Y458.pdb.gz	TBX22_HUMAN T-box transcription factor TBX22 OS=Homo sapiens OX=9606 GN=TBX22 PE=1 SV=3
6	AFDB:O43435	0.425	0.476	2.067E-34	398	0.320	0.359	O43435.pdb.gz	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
7	AFDB:Q13207	0.411	0.260	3.132E-34	712	0.349	0.219	Q13207.pdb.gz	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
8	AFDB:Q8AV66	0.406	0.359	1.381E-33	506	0.356	0.314	Q8AV66.pdb.gz	TBX6_XENLA T-box transcription factor TBX6 OS=Xenopus laevis OX=8355 GN=tbx6 PE=1 SV=2
9	AFDB:Q7ZTU9	0.412	0.270	7.723E-33	687	0.327	0.213	Q7ZTU9.pdb.gz	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
10	AFDB:P90971	0.433	0.554	8.697E-33	346	0.309	0.399	P90971.pdb.gz	TBX12_CAEEL T-box protein 12 OS=Caenorhabditis elegans OX=6239 GN=mab-9 PE=1 SV=2
11	PDB:1rowA	0.099	0.264	5.462E-2	107	0.031	0.131	1rowA.pdb.gz
12	PDB:3zhlA	0.120	0.312	5.796E-2	121	0.036	0.132	3zhlA.pdb.gz
13	PDB:4ziqA	0.153	0.057	5.796E-2	1450	0.031	0.010	4ziqA.pdb.gz
14	PDB:2iqyA	0.112	0.221	6.925E-2	190	0.040	0.095	2iqyA.pdb.gz
15	PDB:7p2pB	0.146	0.280	6.925E-2	179	0.036	0.089	7p2pB.pdb.gz
16	PDB:7ea3J	0.111	0.063	1.113E-1	883	0.029	0.015	7ea3J.pdb.gz
17	PDB:1ln1A	0.065	0.097	1.254E-1	203	0.049	0.108	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
18	PDB:7nxdA	0.096	0.057	1.498E-1	905	0.040	0.020	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
19	PDB:4f38B	0.125	0.243	1.590E-1	192	0.031	0.073	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
20	PDB:1fuxA	0.163	0.363	1.790E-1	165	0.049	0.133	1fuxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8AXW8	0.0	811	441	0.899	0.912	TBX20_XENLA T-box transcription factor TBX20 OS=Xenopus laevis OX=8355 GN=tbx20 PE=2 SV=1
2	Q8UW76	0.0	827	440	0.924	0.939	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
3	Q9ES03	0.0	889	445	0.975	0.980	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
4	Q9I9K7	0.0	800	446	0.866	0.868	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
5	Q9UMR3	0.0	920	447	1.000	1.000	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
6	Q9VMR2	6.30e-107	330	580	0.351	0.271	Q9VMR2_DROME LP04777p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
7	Q8SYY8	1.38e-106	329	571	0.351	0.275	Q8SYY8_DROME RE27439p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
8	Q94890	6.46e-102	319	660	0.333	0.226	H15_DROME T-box protein H15 OS=Drosophila melanogaster OX=7227 GN=H15 PE=2 SV=2
9	Q96SF7	4.97e-97	305	602	0.362	0.269	TBX15_HUMAN T-box transcription factor TBX15 OS=Homo sapiens OX=9606 GN=TBX15 PE=1 SV=2
10	O70306	3.30e-96	303	602	0.360	0.267	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
11	O95935	4.24e-92	292	607	0.306	0.226	TBX18_HUMAN T-box transcription factor TBX18 OS=Homo sapiens OX=9606 GN=TBX18 PE=1 SV=3
12	Q9EPZ6	7.45e-92	292	613	0.306	0.223	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
13	Q9W3F4	3.27e-86	280	699	0.291	0.186	Q9W3F4_DROME Optomotor-blind-related-gene-1, isoform A OS=Drosophila melanogaster OX=7227 GN=org-1 PE=4 SV=1
14	O62535	4.17e-86	280	712	0.291	0.183	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
15	P90971	3.57e-85	266	346	0.273	0.353	TBX12_CAEEL T-box protein 12 OS=Caenorhabditis elegans OX=6239 GN=mab-9 PE=1 SV=2
16	O43435	7.03e-84	265	398	0.275	0.309	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
17	Q8AX98	8.52e-84	266	463	0.289	0.279	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
18	Q8JFF9	9.85e-84	269	554	0.347	0.280	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
19	Q8AXX2	7.76e-83	264	460	0.291	0.283	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
20	P70323	1.22e-82	264	479	0.284	0.265	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01734 Patatin	3.4e+02	12.8	Patatin-like phospholipase
2	PF00907 T-box	1.6e-76	267.9	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327758	0.985	Homeobox protein Nkx-2.5
2	9606.ENSP00000334458	0.937	Transcription factor GATA-4
3	9606.ENSP00000365682	0.915	Transducin-like enhancer protein 1
4	9606.ENSP00000452871	0.903	Transducin-like enhancer protein 3
5	9606.ENSP00000366876	0.859	PHD finger protein 13
6	9606.ENSP00000230658	0.852	Insulin gene enhancer protein ISL-1
7	9606.ENSP00000365720	0.841	Transducin-like enhancer protein 4
8	9606.ENSP00000352565	0.782	Heart- and neural crest derivatives-expressed protein 2
9	9606.ENSP00000329452	0.734	Mitochondrial 2-oxodicarboxylate carrier
10	9606.ENSP00000269216	0.717	Transcription factor GATA-6
11	9606.ENSP00000340874	0.694	Myocyte-specific enhancer factor 2C
12	9606.ENSP00000454562	0.675	Deoxyribonuclease-1-like 2
13	9606.ENSP00000385757	0.657	Biliverdin reductase A
14	9606.ENSP00000061240	0.646	Tolloid-like protein 1
15	9606.ENSP00000252997	0.644	Transcription factor GATA-5
16	9606.ENSP00000320089	0.639	Homeobox protein Nkx-2.6
17	9606.ENSP00000386041	0.639	Myosin-6
18	9606.ENSP00000342828	0.626	Homeobox protein Nkx-2.3
19	9606.ENSP00000484552	0.605	Gap junction alpha-5 protein
20	9606.ENSP00000223364	0.602	Myosin regulatory light chain 2, atrial isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.996	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.997	multicellular organism development
GO:0050794	0.991	regulation of cellular process
GO:0010468	0.987	regulation of gene expression
GO:0048731	0.983	system development
GO:0009987	0.979	cellular process
GO:0009887	0.979	animal organ morphogenesis
GO:0009889	0.976	regulation of biosynthetic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0051252	0.974	regulation of RNA metabolic process
GO:0072359	0.954	circulatory system development
GO:0031326	0.954	regulation of cellular biosynthetic process
GO:0010556	0.950	regulation of macromolecule biosynthetic process
GO:0009888	0.943	tissue development
GO:0006355	0.927	regulation of DNA-templated transcription
GO:0007507	0.926	heart development
GO:0035295	0.897	tube development
GO:0003007	0.858	heart morphogenesis
GO:0048519	0.846	negative regulation of biological process
GO:0003205	0.820	cardiac chamber development
GO:0048518	0.806	positive regulation of biological process
GO:0048522	0.767	positive regulation of cellular process
GO:0003170	0.723	heart valve development
GO:0009893	0.711	positive regulation of metabolic process
GO:0048523	0.679	negative regulation of cellular process
GO:0051239	0.660	regulation of multicellular organismal process
GO:0048729	0.641	tissue morphogenesis
GO:0010604	0.635	positive regulation of macromolecule metabolic process
GO:0010605	0.628	negative regulation of macromolecule metabolic process
GO:0003206	0.624	cardiac chamber morphogenesis
GO:0006357	0.611	regulation of transcription by RNA polymerase II
GO:0031324	0.582	negative regulation of cellular metabolic process
GO:0035239	0.559	tube morphogenesis
GO:1905314	0.559	semi-lunar valve development
GO:0007389	0.545	pattern specification process
GO:0031325	0.515	positive regulation of cellular metabolic process
GO:0048646	0.487	anatomical structure formation involved in morphogenesis
GO:0003179	0.486	heart valve morphogenesis
GO:0051173	0.466	positive regulation of nitrogen compound metabolic process
GO:0050896	0.437	response to stimulus
GO:0050793	0.425	regulation of developmental process
GO:0031328	0.425	positive regulation of cellular biosynthetic process
GO:0045935	0.425	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.419	positive regulation of DNA-templated transcription
GO:0003279	0.398	cardiac septum development
GO:0009890	0.368	negative regulation of biosynthetic process
GO:0048869	0.363	cellular developmental process
GO:0045944	0.357	positive regulation of transcription by RNA polymerase II
GO:0051172	0.351	negative regulation of nitrogen compound metabolic process
GO:0030154	0.347	cell differentiation
GO:0010558	0.343	negative regulation of macromolecule biosynthetic process
GO:0031327	0.343	negative regulation of cellular biosynthetic process
GO:0045934	0.343	negative regulation of nucleobase-containing compound metabolic process
GO:0009790	0.337	embryo development
GO:0045892	0.326	negative regulation of DNA-templated transcription
GO:0003151	0.318	outflow tract morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.980	cytoplasm
GO:0031981	0.386	nuclear lumen
GO:0005654	0.362	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]