StarFunc result for job id Q9UMR5

User Input

>input (302 residues)
MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYIN
ETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRAL
LSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWH
DPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFG
FYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPW
LS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1U9X8D2	0.944	0.944	1.262E-63	302	1.000	1.000	A0A1U9X8D2.pdb.gz	A0A1U9X8D2_HUMAN PPT2 OS=Homo sapiens OX=9606 PE=3 SV=1
2	AFDB:Q9VKH6	0.879	0.921	7.896E-33	288	0.384	0.403	Q9VKH6.pdb.gz	PPT2_DROME Lysosomal thioesterase PPT2 homolog OS=Drosophila melanogaster OX=7227 GN=Ppt2 PE=2 SV=1
3	AFDB:O88531	0.774	0.765	5.205E-21	306	0.278	0.275	O88531.pdb.gz	PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus OX=10090 GN=Ppt1 PE=1 SV=2
4	AFDB:P45478	0.786	0.777	2.036E-20	306	0.272	0.268	P45478.pdb.gz	PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus OX=9913 GN=PPT1 PE=1 SV=1
5	AFDB:Q20390	0.767	0.777	3.471E-20	298	0.255	0.258	Q20390.pdb.gz	PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans OX=6239 GN=ppt-1 PE=2 SV=2
6	PDB:1exwA	0.781	0.844	2.032E-19	279	0.235	0.254	1exwA.pdb.gz	Structural basis for the insensitivity of a serine enzyme (palmitoyl-protein thioesterase) to phenylmethylsulfonyl fluoride.
7	AFDB:A0A286YFF7	0.746	0.676	5.308E-19	335	0.248	0.224	A0A286YFF7.pdb.gz	A0A286YFF7_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1
8	AFDB:Q9LY31	0.735	0.660	2.337E-18	338	0.245	0.219	Q9LY31.pdb.gz	Q9LY31_ARATH AT3G60340 protein OS=Arabidopsis thaliana OX=3702 GN=F27H5_130 PE=1 SV=1
9	AFDB:Q9W3C7	0.763	0.736	1.558E-17	314	0.222	0.213	Q9W3C7.pdb.gz	PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster OX=7227 GN=Ppt1 PE=2 SV=2
10	AFDB:O59747	0.698	0.352	1.170E-16	622	0.222	0.108	O59747.pdb.gz	PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pdf1 PE=1 SV=2
11	AFDB:E9PIA8	0.427	0.597	1.123E-8	208	0.189	0.274	E9PIA8.pdb.gz	E9PIA8_HUMAN Palmitoyl-protein thioesterase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=10
12	PDB:1y7iB	0.448	0.504	1.353E-6	262	0.162	0.187	1y7iB.pdb.gz	Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity
13	PDB:4e15B	0.469	0.467	7.551E-6	303	0.103	0.102	4e15B.pdb.gz
14	PDB:6eicB	0.492	0.527	1.144E-5	279	0.162	0.176	6eicB.pdb.gz
15	PDB:1m33A	0.398	0.460	1.288E-5	256	0.106	0.125	1m33A.pdb.gz	Integrating structure, bioinformatics, and enzymology to discover function: BioH, a new carboxylesterase from Escherichia coli.
16	PDB:1ex9A	0.326	0.343	3.972E-5	285	0.099	0.105	1ex9A.pdb.gz	Crystal structure of pseudomonas aeruginosa lipase in the open conformation. The prototype for family I.1 of bacterial lipases.
17	PDB:1tahB	0.315	0.302	5.035E-5	318	0.116	0.110	1tahB.pdb.gz	The crystal structure of triacylglycerol lipase from Pseudomonas glumae reveals a partially redundant catalytic aspartate.
18	PDB:7dblA	0.518	0.384	5.342E-5	422	0.099	0.071	7dblA.pdb.gz	Structural basis for substrate specificity of the peroxisomal acyl-CoA hydrolase MpaH' involved in mycophenolic acid biosynthesis.
19	PDB:1i6wB	0.454	0.733	6.015E-5	180	0.106	0.178	1i6wB.pdb.gz
20	PDB:2wflA	0.440	0.509	7.186E-5	255	0.132	0.157	2wflA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9X8D2	0.0	625	302	1.000	1.000	A0A1U9X8D2_HUMAN PPT2 OS=Homo sapiens OX=9606 PE=3 SV=1
2	Q9UMR5	0.0	625	302	1.000	1.000	PPT2_HUMAN Lysosomal thioesterase PPT2 OS=Homo sapiens OX=9606 GN=PPT2 PE=1 SV=4
3	G8JLL2	1.34e-131	373	180	0.596	1.000	G8JLL2_HUMAN Palmitoyl-protein thioesterase 2 (Fragment) OS=Homo sapiens OX=9606 GN=PPT2 PE=1 SV=1
4	Q9VKH6	1.69e-71	224	288	0.381	0.399	PPT2_DROME Lysosomal thioesterase PPT2 homolog OS=Drosophila melanogaster OX=7227 GN=Ppt2 PE=2 SV=1
5	P45478	4.65e-18	84.7	306	0.248	0.245	PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus OX=9913 GN=PPT1 PE=1 SV=1
6	P50897	7.70e-17	81.3	306	0.245	0.242	PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1
7	O88531	1.24e-16	80.9	306	0.275	0.271	PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus OX=10090 GN=Ppt1 PE=1 SV=2
8	A0A286YFF7	1.25e-16	81.3	335	0.238	0.215	A0A286YFF7_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1
9	P45479	7.81e-16	78.6	306	0.228	0.225	PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Ppt1 PE=1 SV=1
10	A0A2C9F2P4	1.45e-15	77.8	305	0.245	0.243	A0A2C9F2P4_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1
11	E9PIA8	8.75e-13	68.2	208	0.132	0.192	E9PIA8_HUMAN Palmitoyl-protein thioesterase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=10
12	Q20390	1.72e-12	68.9	298	0.248	0.252	PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans OX=6239 GN=ppt-1 PE=2 SV=2
13	Q9LY31	3.31e-12	68.2	338	0.235	0.210	Q9LY31_ARATH AT3G60340 protein OS=Arabidopsis thaliana OX=3702 GN=F27H5_130 PE=1 SV=1
14	O59747	4.49e-10	62.4	622	0.238	0.116	PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pdf1 PE=1 SV=2
15	Q9W3C7	1.23e-07	54.3	314	0.159	0.153	PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster OX=7227 GN=Ppt1 PE=2 SV=2
16	E9PSE5	0.099	34.3	87	0.063	0.218	E9PSE5_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1
17	P0DUB8	0.29	35.0	358	0.146	0.123	LIP_BURPL Triacylglycerol lipase OS=Burkholderia plantarii OX=41899 GN=lip PE=1 SV=1
18	P37957	0.35	34.3	212	0.053	0.075	ESTA_BACSU Lipase EstA OS=Bacillus subtilis (strain 168) OX=224308 GN=estA PE=1 SV=2
19	O33185	0.76	33.9	999	0.053	0.016	O33185_MYCTU Possible bifunctional enzyme long-chain acyl-CoA synthase and lipase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1683 PE=1 SV=3
20	Q10099	1.1	33.1	339	0.056	0.050	SEH1_SCHPO Nucleoporin seh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=seh1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	0.0025	29.1	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	0.34	23.0	Alpha/beta hydrolase family
3	PF05057 DUF676	0.88	20.6	Putative serine esterase (DUF676)
4	PF01674 Lipase_2	11	17.0	Lipase (class 2)
5	PF02089 Palm_thioest	9.5e-60	214.1	Palmitoyl protein thioesterase
6	PF07819 PGAP1	10	17.4	PGAP1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354608

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263702	0.905	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
2	9606.ENSP00000394863	0.863	Palmitoyl-protein thioesterase 1
3	9606.ENSP00000378888	0.711	Epidermal growth factor-like protein 8
4	9606.ENSP00000364482	0.680	Serine/threonine-protein kinase 19
5	9606.ENSP00000249806	0.667	CLN6, transmembrane ER protein
6	9606.ENSP00000415433	0.660	Integrator complex subunit 12
7	9606.ENSP00000438248	0.648	Calumenin
8	9606.ENSP00000355889	0.644	Isoleucine--tRNA ligase, mitochondrial
9	9606.ENSP00000380466	0.641	Mitochondrial ribosomal protein L23
10	9606.ENSP00000279242	0.640	Mitochondrial ribosomal protein L49
11	9606.ENSP00000472847	0.639	Serine--tRNA ligase, mitochondrial
12	9606.ENSP00000377532	0.632	Pyruvate carboxylase, mitochondrial
13	9606.ENSP00000422354	0.630	Glutathione S-transferase C-terminal domain containing
14	9606.ENSP00000320043	0.623	Acyl-protein thioesterase 1
15	9606.ENSP00000269141	0.620	Cadherin-2
16	9606.ENSP00000254976	0.616	Synaptosomal-associated protein 25
17	9606.ENSP00000355955	0.616	Neudesin
18	9606.ENSP00000216605	0.615	C-1-tetrahydrofolate synthase, cytoplasmic
19	9606.ENSP00000470252	0.615	Transcription elongation factor SPT5
20	9606.ENSP00000317331	0.613	Translocon-associated protein subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0098599	0.999	palmitoyl hydrolase activity
GO:0016788	0.678	hydrolase activity, acting on ester bonds
GO:0005515	0.647	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006796	0.989	phosphate-containing compound metabolic process
GO:1901576	0.985	organic substance biosynthetic process
GO:0044249	0.985	cellular biosynthetic process
GO:0006139	0.985	nucleobase-containing compound metabolic process
GO:0043603	0.975	amide metabolic process
GO:0034030	0.974	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.974	purine nucleoside bisphosphate biosynthetic process
GO:0035384	0.973	thioester biosynthetic process
GO:0009152	0.973	purine ribonucleotide biosynthetic process
GO:0035337	0.972	fatty-acyl-CoA metabolic process
GO:0043604	0.971	amide biosynthetic process
GO:0071616	0.938	acyl-CoA biosynthetic process
GO:1901570	0.814	fatty acid derivative biosynthetic process
GO:0065007	0.393	biological regulation
GO:0043170	0.337	macromolecule metabolic process
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0005737	0.991	cytoplasm
GO:0031982	0.970	vesicle
GO:0005576	0.968	extracellular region
GO:0005615	0.923	extracellular space
GO:0070062	0.896	extracellular exosome
GO:0000323	0.583	lytic vacuole
GO:0005764	0.563	lysosome
GO:0016020	0.468	membrane
GO:0031981	0.415	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.999	Hydrolases.
EC:3.1.-.-	0.678	Acting on ester bonds.

[back to server]