StarFunc result for job id Q9UMR7

User Input

>input (237 residues)
MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAIS
FFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFI
STESASWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWVD
QTPYNESSTFWHPREPSDPNERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMKIHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UMR7	1.000	1.000	1.098E-41	237	1.000	1.000	Q9UMR7.pdb.gz	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
2	AFDB:Q5YIR8	0.638	0.641	2.365E-27	236	0.506	0.508	Q5YIR8.pdb.gz	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1
3	AFDB:Q9QZ15	0.638	0.635	3.126E-27	238	0.536	0.534	Q9QZ15.pdb.gz	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
4	AFDB:Q8WTT0	0.628	0.698	2.614E-23	213	0.409	0.455	Q8WTT0.pdb.gz	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
5	AFDB:Q9JKF4	0.634	0.717	8.428E-23	209	0.367	0.416	Q9JKF4.pdb.gz	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
6	AFDB:Q67DU8	0.620	0.704	1.645E-22	208	0.380	0.433	Q67DU8.pdb.gz	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
7	AFDB:Q6EIG7	0.631	0.714	1.839E-22	209	0.354	0.402	Q6EIG7.pdb.gz	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
8	AFDB:Q7TS58	0.625	0.706	6.271E-22	209	0.384	0.435	Q7TS58.pdb.gz	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
9	AFDB:Q8WXI8	0.691	0.752	1.077E-20	215	0.304	0.335	Q8WXI8.pdb.gz	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
10	AFDB:Q9D8Q7	0.570	0.763	1.041E-18	176	0.376	0.506	Q9D8Q7.pdb.gz	Q9D8Q7_MOUSE C-type lectin domain family 4, member b1 OS=Mus musculus OX=10090 GN=Clec4b1 PE=1 SV=1
11	PDB:1qddA	0.482	0.774	4.343E-10	144	0.156	0.257	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
12	PDB:7wz8A	0.496	0.646	6.416E-10	180	0.198	0.261	7wz8A.pdb.gz
13	PDB:5f2qB	0.465	0.786	1.481E-9	135	0.143	0.252	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:2kv3A	0.446	0.756	1.025E-7	131	0.143	0.260	2kv3A.pdb.gz
15	PDB:4mthA	0.457	0.752	2.000E-7	139	0.135	0.230	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
16	PDB:1htnA	0.467	0.692	3.493E-7	156	0.114	0.173	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
17	PDB:1gz2A	0.468	0.770	3.693E-7	139	0.127	0.216	1gz2A.pdb.gz
18	PDB:7qsrA	0.443	0.086	6.100E-7	1335	0.143	0.025	7qsrA.pdb.gz
19	PDB:1bj3B	0.360	0.656	9.528E-7	123	0.135	0.260	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
20	PDB:7jptA	0.435	0.082	1.126E-6	1327	0.135	0.024	7jptA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMR7	9.23e-180	494	237	1.000	1.000	CLC4A_HUMAN C-type lectin domain family 4 member A OS=Homo sapiens OX=9606 GN=CLEC4A PE=1 SV=1
2	Q9QZ15	8.62e-79	238	238	0.544	0.542	CLC4A_MOUSE C-type lectin domain family 4 member A OS=Mus musculus OX=10090 GN=Clec4a PE=1 SV=1
3	Q5YIR8	8.77e-75	228	236	0.511	0.513	Q5YIR8_MOUSE C-type lectin domain family 4, member a4 OS=Mus musculus OX=10090 GN=Clec4a4 PE=1 SV=1
4	Q8WTT0	8.23e-67	207	213	0.409	0.455	CLC4C_HUMAN C-type lectin domain family 4 member C OS=Homo sapiens OX=9606 GN=CLEC4C PE=1 SV=1
5	Q9JKF4	1.53e-57	183	209	0.367	0.416	CLC6A_MOUSE C-type lectin domain family 6 member A OS=Mus musculus OX=10090 GN=Clec6a PE=1 SV=1
6	Q7TS58	5.71e-57	182	209	0.384	0.435	Q7TS58_MOUSE Antigen presenting cell lectin-like receptor A2 OS=Mus musculus OX=10090 GN=Clec4b1 PE=2 SV=1
7	Q67DU8	3.47e-56	180	208	0.384	0.438	Q67DU8_MOUSE Antigen presenting cell lectin-like receptor A1 OS=Mus musculus OX=10090 GN=Clec4b2 PE=2 SV=1
8	Q6EIG7	1.08e-53	173	209	0.350	0.397	CLC6A_HUMAN C-type lectin domain family 6 member A OS=Homo sapiens OX=9606 GN=CLEC6A PE=1 SV=1
9	Q9D8Q7	2.11e-52	169	176	0.338	0.455	Q9D8Q7_MOUSE C-type lectin domain family 4, member b1 OS=Mus musculus OX=10090 GN=Clec4b1 PE=1 SV=1
10	Q8WXI8	2.14e-44	150	215	0.304	0.335	CLC4D_HUMAN C-type lectin domain family 4 member D OS=Homo sapiens OX=9606 GN=CLEC4D PE=1 SV=2
11	Q69FH1	2.05e-36	129	218	0.262	0.284	CLC4D_RAT C-type lectin domain family 4 member D OS=Rattus norvegicus OX=10116 GN=Clec4d PE=1 SV=1
12	Q9Z2H6	5.89e-36	128	219	0.287	0.311	CLC4D_MOUSE C-type lectin domain family 4 member D OS=Mus musculus OX=10090 GN=Clec4d PE=1 SV=1
13	Q67EQ1	1.02e-35	127	215	0.278	0.307	CLC4E_RAT C-type lectin domain family 4 member E OS=Rattus norvegicus OX=10116 GN=Clec4e PE=1 SV=1
14	Q9ULY5	3.45e-34	124	219	0.295	0.320	CLC4E_HUMAN C-type lectin domain family 4 member E OS=Homo sapiens OX=9606 GN=CLEC4E PE=1 SV=1
15	Q9R0Q8	2.75e-28	108	214	0.241	0.266	CLC4E_MOUSE C-type lectin domain family 4 member E OS=Mus musculus OX=10090 GN=Clec4e PE=1 SV=1
16	Q8IUN9	1.27e-20	90.5	316	0.236	0.177	CLC10_HUMAN C-type lectin domain family 10 member A OS=Homo sapiens OX=9606 GN=CLEC10A PE=1 SV=1
17	L0N7P8	8.12e-19	83.6	216	0.177	0.194	L0N7P8_ONCMY CD209 antigen-like protein A OS=Oncorhynchus mykiss OX=8022 GN=cd209A PE=2 SV=1
18	D3Z5D4	1.26e-18	82.8	194	0.194	0.237	D3Z5D4_MOUSE CD209g antigen OS=Mus musculus OX=10090 GN=Cd209g PE=4 SV=1
19	Q91ZW7	2.36e-18	82.4	208	0.186	0.212	C209E_MOUSE CD209 antigen-like protein E OS=Mus musculus OX=10090 GN=Cd209e PE=2 SV=1
20	Q9H2X3	4.62e-18	84.3	399	0.203	0.120	CLC4M_HUMAN C-type lectin domain family 4 member M OS=Homo sapiens OX=9606 GN=CLEC4M PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	1.8e-18	78.6	Lectin C-type domain
2	PF05473 UL45	8.8e+02	10.9	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.761	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000312082	0.743	Toll-like receptor 8
3	9606.ENSP00000262629	0.734	TYRO protein tyrosine kinase-binding protein
4	9606.ENSP00000263636	0.724	Lymphocyte antigen 75
5	9606.ENSP00000392770	0.704	Membrane-spanning 4-domains subfamily A member 6A
6	9606.ENSP00000375629	0.669	Leukocyte immunoglobulin-like receptor subfamily B member 2
7	9606.ENSP00000268389	0.668	Immunoglobulin superfamily member 6
8	9606.ENSP00000075120	0.648	Solute carrier family 2, facilitated glucose transporter member 3
9	9606.ENSP00000248598	0.610	Fibroleukin
10	9606.ENSP00000391592	0.598	Tyrosine-protein phosphatase non-receptor type 6
11	9606.ENSP00000260010	0.596	Toll-like receptor 2
12	9606.ENSP00000444986	0.589	Tyrosine-protein kinase HCK
13	9606.ENSP00000357123	0.588	Myeloid cell nuclear differentiation antigen
14	9606.ENSP00000357152	0.564	T-cell surface glycoprotein CD1c
15	9606.ENSP00000291759	0.558	Leukocyte immunoglobulin-like receptor subfamily A member 4
16	9606.ENSP00000229304	0.550	C->U-editing enzyme APOBEC-1
17	9606.ENSP00000354932	0.544	Toll-like receptor 1
18	9606.ENSP00000332049	0.538	T-lymphocyte activation antigen CD86
19	9606.ENSP00000289902	0.533	High affinity immunoglobulin epsilon receptor subunit gamma
20	9606.ENSP00000011653	0.522	T-cell surface glycoprotein CD4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0030246	1.000	carbohydrate binding
GO:0005515	1.000	protein binding
GO:0036094	0.996	small molecule binding
GO:0048029	0.961	monosaccharide binding
GO:0043167	0.888	ion binding
GO:0004888	0.876	transmembrane signaling receptor activity
GO:0005509	0.870	calcium ion binding
GO:0005537	0.869	mannose binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.997	regulation of biological process
GO:0050896	0.995	response to stimulus
GO:0002376	0.995	immune system process
GO:0050794	0.991	regulation of cellular process
GO:0023052	0.974	signaling
GO:0007154	0.973	cell communication
GO:0051716	0.966	cellular response to stimulus
GO:0001817	0.958	regulation of cytokine production
GO:0007165	0.937	signal transduction
GO:0001775	0.929	cell activation
GO:0048518	0.869	positive regulation of biological process
GO:0045321	0.862	leukocyte activation
GO:0007166	0.805	cell surface receptor signaling pathway
GO:0046649	0.733	lymphocyte activation
GO:0032680	0.709	regulation of tumor necrosis factor production
GO:0048583	0.677	regulation of response to stimulus
GO:0002682	0.617	regulation of immune system process
GO:0048519	0.612	negative regulation of biological process
GO:0042110	0.608	T cell activation
GO:0048522	0.529	positive regulation of cellular process
GO:0006955	0.493	immune response
GO:0051240	0.476	positive regulation of multicellular organismal process
GO:0009893	0.468	positive regulation of metabolic process
GO:0010604	0.462	positive regulation of macromolecule metabolic process
GO:0050776	0.448	regulation of immune response
GO:0002684	0.437	positive regulation of immune system process
GO:0006950	0.435	response to stress
GO:0006952	0.432	defense response
GO:0048584	0.415	positive regulation of response to stimulus
GO:0009605	0.405	response to external stimulus
GO:0031347	0.389	regulation of defense response
GO:0009607	0.387	response to biotic stimulus
GO:0032101	0.377	regulation of response to external stimulus
GO:0050778	0.374	positive regulation of immune response
GO:0044419	0.341	biological process involved in interspecies interaction between organisms
GO:0051241	0.332	negative regulation of multicellular organismal process
GO:0010628	0.314	positive regulation of gene expression
GO:0051707	0.305	response to other organism
GO:0009892	0.300	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0012505	0.946	endomembrane system
GO:0043227	0.928	membrane-bounded organelle
GO:0043229	0.906	intracellular organelle
GO:0043231	0.904	intracellular membrane-bounded organelle
GO:0005737	0.889	cytoplasm
GO:0031982	0.868	vesicle
GO:0031410	0.788	cytoplasmic vesicle
GO:0030659	0.726	cytoplasmic vesicle membrane
GO:0098588	0.369	bounding membrane of organelle
GO:0030141	0.367	secretory granule
GO:0030667	0.306	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]