StarFunc result for job id Q9UMS0

User Input

>input (254 residues)
MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMF
IQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFIT
VTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTR
IRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQ
VMDDESDEKEANSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UMS0	1.000	1.000	2.250E-51	254	1.000	1.000	Q9UMS0.pdb.gz	NFU1_HUMAN NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Homo sapiens OX=9606 GN=NFU1 PE=1 SV=2
2	AFDB:Q9QZ23	0.783	0.780	1.853E-44	255	0.878	0.875	Q9QZ23.pdb.gz	NFU1_MOUSE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Mus musculus OX=10090 GN=Nfu1 PE=1 SV=2
3	AFDB:Q9C8J2	0.730	0.676	2.300E-29	275	0.457	0.422	Q9C8J2.pdb.gz	NIFU5_ARATH NifU-like protein 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFU5 PE=2 SV=1
4	AFDB:Q21915	0.725	0.808	6.734E-29	227	0.461	0.515	Q21915.pdb.gz	Q21915_CAEEL NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lpd-8 PE=1 SV=2
5	AFDB:Q9LIG6	0.743	0.670	4.483E-28	283	0.453	0.406	Q9LIG6.pdb.gz	NIFU4_ARATH NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFU4 PE=2 SV=1
6	AFDB:Q9UUB8	0.712	0.696	1.644E-26	260	0.382	0.373	Q9UUB8.pdb.gz	YH9J_SCHPO NifU-like protein C1709.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1709.19c PE=3 SV=1
7	AFDB:Q57V38	0.709	0.645	5.166E-24	280	0.350	0.318	Q57V38.pdb.gz	Q57V38_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.100 PE=3 SV=1
8	AFDB:P32860	0.680	0.675	3.165E-20	256	0.335	0.332	P32860.pdb.gz	NFU1_YEAST NifU-like protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFU1 PE=1 SV=2
9	AFDB:Q38B74	0.653	0.636	7.786E-16	261	0.248	0.241	Q38B74.pdb.gz	Q38B74_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1780 PE=3 SV=1
10	AFDB:Q389M3	0.382	0.397	1.321E-9	243	0.165	0.173	Q389M3.pdb.gz	Q389M3_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0860 PE=3 SV=1
11	PDB:2pa8L	0.190	0.433	5.472E-2	92	0.055	0.152	2pa8L.pdb.gz	The X-ray crystal structure of RNA polymerase from Archaea.
12	PDB:7ok0L	0.169	0.397	7.995E-2	90	0.059	0.167	7ok0L.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
13	PDB:3i0uB	0.148	0.178	1.244E-1	198	0.071	0.091	3i0uB.pdb.gz
14	PDB:3i4mK	0.174	0.330	1.412E-1	116	0.055	0.121	3i4mK.pdb.gz	Molecular basis of transcriptional mutagenesis at 8-oxoguanine
15	PDB:5iy6K	0.170	0.307	1.602E-1	117	0.059	0.128	5iy6K.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
16	PDB:7aocK	0.174	0.373	2.341E-1	95	0.043	0.116	7aocK.pdb.gz	Conserved strategies of RNA polymerase I hibernation and activation.
17	PDB:3ieuA	0.223	0.198	2.493E-1	293	0.063	0.055	3ieuA.pdb.gz	Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis
18	PDB:1yg0A	0.146	0.475	2.829E-1	66	0.035	0.136	1yg0A.pdb.gz
19	PDB:7eu1K	0.182	0.393	3.643E-1	97	0.051	0.134	7eu1K.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
20	PDB:3h0gK	0.180	0.320	3.880E-1	119	0.071	0.151	3h0gK.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMS0	0.0	527	254	1.000	1.000	NFU1_HUMAN NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Homo sapiens OX=9606 GN=NFU1 PE=1 SV=2
2	Q9QZ23	2.99e-154	431	255	0.850	0.847	NFU1_MOUSE NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Mus musculus OX=10090 GN=Nfu1 PE=1 SV=2
3	Q21915	1.93e-79	240	227	0.453	0.507	Q21915_CAEEL NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lpd-8 PE=1 SV=2
4	Q9LIG6	9.88e-75	230	283	0.437	0.392	NIFU4_ARATH NifU-like protein 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFU4 PE=2 SV=1
5	Q9C8J2	4.84e-74	228	275	0.437	0.404	NIFU5_ARATH NifU-like protein 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NIFU5 PE=2 SV=1
6	Q9UUB8	3.79e-59	190	260	0.386	0.377	YH9J_SCHPO NifU-like protein C1709.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1709.19c PE=3 SV=1
7	Q57V38	1.18e-40	143	280	0.339	0.307	Q57V38_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.100 PE=3 SV=1
8	P32860	1.41e-40	142	256	0.339	0.336	NFU1_YEAST NifU-like protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFU1 PE=1 SV=2
9	Q38B74	3.66e-22	94.0	261	0.256	0.249	Q38B74_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1780 PE=3 SV=1
10	Q389M3	1.24e-17	81.6	243	0.165	0.173	Q389M3_TRYB2 HIRA-interacting protein 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0860 PE=3 SV=1
11	Q84RQ7	2.43e-13	69.7	236	0.138	0.148	NIFU3_ARATH NifU-like protein 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NIFU3 PE=2 SV=1
12	Q93W20	1.41e-12	67.4	235	0.130	0.140	NIFU2_ARATH NifU-like protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NIFU2 PE=1 SV=1
13	P74558	2.52e-12	62.8	76	0.126	0.421	P74558_SYNY3 NifU protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ssl2667 PE=4 SV=1
14	Q93W77	2.36e-10	61.2	231	0.118	0.130	NIFU1_ARATH NifU-like protein 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NIFU1 PE=1 SV=1
15	Q72EB3	2.46e-07	52.8	281	0.094	0.085	Q72EB3_DESVH Nitrogen fixation protein NifU OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0665 PE=1 SV=1
16	P63020	1.26e-04	43.9	191	0.098	0.131	NFUA_ECOLI Fe/S biogenesis protein NfuA OS=Escherichia coli (strain K12) OX=83333 GN=nfuA PE=1 SV=1
17	Q91785	2.2	32.3	1388	0.114	0.021	KI15A_XENLA Kinesin-like protein KIF15-A OS=Xenopus laevis OX=8355 GN=kif15-a PE=1 SV=1
18	Q7ZUI2	2.6	31.6	315	0.098	0.079	Q7ZUI2_DANRE Ras-related GTP-binding protein OS=Danio rerio OX=7955 GN=zgc:56499 PE=1 SV=1
19	P27825	5.0	30.8	502	0.110	0.056	CALX_YEAST Calnexin homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CNE1 PE=1 SV=1
20	A2AN08	6.4	30.8	5180	0.106	0.005	UBR4_MOUSE E3 ubiquitin-protein ligase UBR4 OS=Mus musculus OX=10090 GN=Ubr4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08712 Nfu_N	9.8e-30	113.8	Scaffold protein Nfu/NifU N terminal
2	PF01106 NifU	7.4e-22	88.6	NifU-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310623	0.995	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
2	9606.ENSP00000328570	0.984	Glutaredoxin-related protein 5, mitochondrial
3	9606.ENSP00000365159	0.972	Iron-sulfur cluster assembly 1 homolog, mitochondrial
4	9606.ENSP00000452007	0.968	Iron-sulfur cluster assembly 2 homolog, mitochondrial
5	9606.ENSP00000363205	0.964	Cysteine desulfurase, mitochondrial
6	9606.ENSP00000355672	0.959	Putative transferase CAF17, mitochondrial
7	9606.ENSP00000331369	0.956	BolA-like protein 3
8	9606.ENSP00000261434	0.950	Lipoyl synthase, mitochondrial
9	9606.ENSP00000216027	0.929	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
10	9606.ENSP00000357633	0.920	Glutaredoxin-3
11	9606.ENSP00000420026	0.904	LYR motif-containing protein 4
12	9606.ENSP00000356489	0.901	Laforin
13	9606.ENSP00000377311	0.894	Ferredoxin-2, mitochondrial
14	9606.ENSP00000358149	0.891	BolA-like protein 1
15	9606.ENSP00000366482	0.889	Frataxin, mitochondrial
16	9606.ENSP00000253577	0.858	ATP-binding cassette sub-family B member 7, mitochondrial
17	9606.ENSP00000254663	0.849	Selenocysteine lyase
18	9606.ENSP00000260270	0.840	Adrenodoxin, mitochondrial
19	9606.ENSP00000281081	0.832	Iron-sulfur protein NUBPL
20	9606.ENSP00000216254	0.820	Aconitate hydratase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046914	0.922	transition metal ion binding
GO:0051536	0.633	iron-sulfur cluster binding
GO:0051539	0.508	4 iron, 4 sulfur cluster binding
GO:0005506	0.477	iron ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.995	metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0016226	0.982	iron-sulfur cluster assembly
GO:0071704	0.527	organic substance metabolic process
GO:0006807	0.350	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005654	0.995	nucleoplasm
GO:0005829	0.982	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]