StarFunc result for job id Q9UMW8

User Input

>input (372 residues)
MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI
GQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRP
LELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVD
CAMESSRNSSMLTLPLSLFDVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGK
QVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
QYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQE
TAYLLVYMKMEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UMW8	1.000	1.000	1.609E-78	372	1.000	1.000	Q9UMW8.pdb.gz	UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens OX=9606 GN=USP18 PE=1 SV=1
2	AFDB:Q3LFD5	0.822	0.854	2.394E-58	358	0.815	0.846	Q3LFD5.pdb.gz
3	AFDB:Q9WTV6	0.840	0.849	1.020E-56	368	0.661	0.668	Q9WTV6.pdb.gz	UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus OX=10090 GN=Usp18 PE=1 SV=2
4	AFDB:E7EYZ1	0.785	0.862	4.225E-34	337	0.274	0.303	E7EYZ1.pdb.gz	E7EYZ1_DANRE Ubiquitin-specific peptidase 18 OS=Danio rerio OX=7955 GN=usp18 PE=4 SV=1
5	AFDB:Q8BY87	0.767	0.215	6.849E-31	1376	0.266	0.072	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
6	AFDB:Q24574	0.765	0.191	2.260E-30	1556	0.280	0.067	Q24574.pdb.gz	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
7	AFDB:Q22240	0.757	0.223	1.653E-29	1326	0.261	0.073	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
8	AFDB:E7EY58	0.726	0.257	6.657E-28	1092	0.247	0.084	E7EY58.pdb.gz
9	AFDB:O57429	0.716	0.744	1.049E-27	357	0.226	0.235	O57429.pdb.gz	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
10	AFDB:Q6P8X6	0.695	0.664	1.110E-27	390	0.215	0.205	Q6P8X6.pdb.gz	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
11	PDB:5cvnB	0.721	0.830	5.704E-26	321	0.199	0.231	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
12	PDB:5k16B	0.683	0.766	5.389E-24	328	0.202	0.229	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:3mhsA	0.677	0.561	1.128E-23	455	0.207	0.169	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:7yxxA	0.680	0.157	1.338E-23	1754	0.228	0.048	7yxxA.pdb.gz
15	PDB:7w3ax	0.700	0.536	3.619E-22	494	0.194	0.146	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	PDB:8a9kD	0.639	0.820	9.514E-22	285	0.199	0.260	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
17	PDB:5gjqx	0.675	0.706	1.778E-21	355	0.194	0.203	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
18	PDB:7ay1D	0.699	0.759	2.802E-21	341	0.220	0.240	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
19	PDB:7qo48	0.685	0.685	1.542E-20	372	0.207	0.207	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
20	PDB:4wa6D	0.596	0.537	3.723E-19	415	0.191	0.171	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMW8	0.0	778	372	1.000	1.000	UBP18_HUMAN Ubl carboxyl-terminal hydrolase 18 OS=Homo sapiens OX=9606 GN=USP18 PE=1 SV=1
2	Q9WTV6	0.0	533	368	0.704	0.712	UBP18_MOUSE Ubl carboxyl-terminal hydrolase 18 OS=Mus musculus OX=10090 GN=Usp18 PE=1 SV=2
3	E7EYZ1	4.22e-48	167	337	0.288	0.318	E7EYZ1_DANRE Ubiquitin-specific peptidase 18 OS=Danio rerio OX=7955 GN=usp18 PE=4 SV=1
4	Q8BY87	2.15e-36	142	1376	0.269	0.073	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
5	Q96K76	3.10e-36	142	1375	0.263	0.071	UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3
6	Q22240	1.66e-28	119	1326	0.269	0.075	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
7	A0A0R4IB93	1.84e-28	119	1047	0.250	0.089	UBP48_DANRE Ubiquitin carboxyl-terminal hydrolase 48 OS=Danio rerio OX=7955 GN=usp48 PE=3 SV=1
8	Q24574	2.19e-25	110	1556	0.204	0.049	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
9	Q9UTT1	5.88e-24	105	1129	0.253	0.083	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
10	Q86UV5	2.28e-22	101	1035	0.228	0.082	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
11	Q76LT8	2.72e-22	100	1036	0.242	0.087	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
12	Q09879	1.24e-21	99.0	1108	0.202	0.068	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
13	Q6A4J8	1.91e-21	98.6	1103	0.245	0.083	UBP7_MOUSE Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus OX=10090 GN=Usp7 PE=1 SV=1
14	Q9VYQ8	3.00e-21	97.8	1129	0.226	0.074	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
15	P50101	3.94e-21	97.8	1230	0.215	0.065	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
16	Q93009	8.99e-21	96.7	1102	0.242	0.082	UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2
17	Q4VSI4	9.33e-21	96.3	1103	0.242	0.082	UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1
18	G3MU80	1.01e-20	96.3	1132	0.231	0.076	G3MU80_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
19	O45623	1.01e-20	96.3	1133	0.231	0.076	O45623_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
20	G3MU83	1.08e-20	96.3	1134	0.231	0.076	G3MU83_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04658 TAFII55_N	1.5e+02	13.6	TAFII55 protein conserved region
2	PF00443 UCH	3.5e-37	140.0	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	5.8e-14	64.0	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343957	0.999	Interferon alpha/beta receptor 2
2	9606.ENSP00000368699	0.999	Ubiquitin-like protein ISG15
3	9606.ENSP00000360869	0.995	Interferon-induced protein with tetratricopeptide repeats 1
4	9606.ENSP00000381601	0.994	Interferon-induced GTP-binding protein Mx1
5	9606.ENSP00000369213	0.989	Probable ATP-dependent RNA helicase DDX58
6	9606.ENSP00000333657	0.985	Interferon-induced GTP-binding protein Mx2
7	9606.ENSP00000354394	0.983	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000233057	0.967	Interferon-induced, double-stranded RNA-activated protein kinase
9	9606.ENSP00000371471	0.964	Radical S-adenosyl methionine domain-containing protein 2
10	9606.ENSP00000343204	0.958	Tyrosine-protein kinase JAK1
11	9606.ENSP00000360883	0.941	Interferon-induced protein with tetratricopeptide repeats 3
12	9606.ENSP00000315768	0.934	Signal transducer and activator of transcription 2
13	9606.ENSP00000303709	0.930	Ubiquitin-conjugating enzyme E2 E1
14	9606.ENSP00000216160	0.917	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
15	9606.ENSP00000380697	0.917	Interferon regulatory factor 7
16	9606.ENSP00000257570	0.915	2'-5'-oligoadenylate synthase-like protein
17	9606.ENSP00000264350	0.912	E3 ISG15--protein ligase HERC5
18	9606.ENSP00000263025	0.909	Mitogen-activated protein kinase 3
19	9606.ENSP00000244007	0.902	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
20	9606.ENSP00000263642	0.890	Interferon-induced helicase C domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0070647	0.990	protein modification by small protein conjugation or removal
GO:0050794	0.987	regulation of cellular process
GO:0006508	0.984	proteolysis
GO:0070646	0.970	protein modification by small protein removal
GO:0016579	0.931	protein deubiquitination
GO:0048519	0.901	negative regulation of biological process
GO:0048583	0.897	regulation of response to stimulus
GO:0045088	0.881	regulation of innate immune response
GO:0050896	0.878	response to stimulus
GO:0048523	0.816	negative regulation of cellular process
GO:0060759	0.812	regulation of response to cytokine stimulus
GO:0009966	0.805	regulation of signal transduction
GO:0001959	0.789	regulation of cytokine-mediated signaling pathway
GO:0023057	0.763	negative regulation of signaling
GO:0010648	0.763	negative regulation of cell communication
GO:0002683	0.756	negative regulation of immune system process
GO:0048585	0.745	negative regulation of response to stimulus
GO:0050777	0.725	negative regulation of immune response
GO:0009968	0.722	negative regulation of signal transduction
GO:0032102	0.718	negative regulation of response to external stimulus
GO:0031348	0.718	negative regulation of defense response
GO:0045824	0.696	negative regulation of innate immune response
GO:0060338	0.639	regulation of type I interferon-mediated signaling pathway
GO:0060761	0.604	negative regulation of response to cytokine stimulus
GO:0001960	0.577	negative regulation of cytokine-mediated signaling pathway
GO:0044419	0.521	biological process involved in interspecies interaction between organisms
GO:0009607	0.484	response to biotic stimulus
GO:0009605	0.476	response to external stimulus
GO:0051707	0.463	response to other organism
GO:0009987	0.462	cellular process
GO:0019222	0.388	regulation of metabolic process
GO:0048518	0.351	positive regulation of biological process
GO:0060255	0.351	regulation of macromolecule metabolic process
GO:0010033	0.332	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.999	cytosol
GO:0043233	0.696	organelle lumen
GO:0070013	0.683	intracellular organelle lumen
GO:0031981	0.417	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]