StarFunc result for job id Q9UMX0

User Input

>input (589 residues)
MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTVKTPKEKEEFAVPENSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQT
NTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGLNTTNFSELQSQMQRQLL
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTA
PNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
NPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGL
IPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGTTEPGHQQFIQQMLQALAGVNPQL
QNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UMX0	1.000	1.000	6.265E-85	589	1.000	1.000	Q9UMX0.pdb.gz	UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2
2	AFDB:Q9JJP9	0.632	0.639	1.378E-73	582	0.868	0.878	Q9JJP9.pdb.gz	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
3	AFDB:A0A024R258	0.226	0.234	8.522E-71	561	0.952	1.000	A0A024R258.pdb.gz
4	AFDB:Q9UHD9	0.430	0.412	2.518E-64	624	0.795	0.750	Q9UHD9.pdb.gz	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
5	AFDB:D4AA63	0.427	0.399	4.839E-62	638	0.757	0.699	D4AA63.pdb.gz	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
6	AFDB:Q9NRR5	0.379	0.373	1.272E-55	601	0.640	0.627	Q9NRR5.pdb.gz	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
7	AFDB:Q9VWD9	0.316	0.330	1.087E-46	547	0.482	0.519	Q9VWD9.pdb.gz	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
8	AFDB:Q9SII8	0.203	0.213	4.861E-28	551	0.331	0.354	Q9SII8.pdb.gz	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
9	AFDB:Q9NIF3	0.179	0.199	4.796E-25	523	0.319	0.359	Q9NIF3.pdb.gz	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
10	AFDB:Q9D4I8	0.158	0.176	3.450E-21	510	0.289	0.333	Q9D4I8.pdb.gz	Q9D4I8_MOUSE Ubiquilin 5 OS=Mus musculus OX=10090 GN=Ubqln5 PE=1 SV=1
11	PDB:4pyuA	0.125	0.909	1.566E-6	76	0.025	0.197	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
12	PDB:7rbsB	0.127	0.463	1.661E-6	157	0.031	0.115	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:6yvaC	0.128	0.471	2.500E-6	155	0.029	0.110	6yvaC.pdb.gz
14	PDB:5xqmA	0.122	0.711	3.348E-6	90	0.029	0.189	5xqmA.pdb.gz
15	PDB:6mdhA	0.124	0.476	4.229E-6	149	0.027	0.107	6mdhA.pdb.gz
16	PDB:3dbhI	0.132	0.818	5.343E-6	86	0.036	0.244	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
17	PDB:3plvA	0.120	0.854	6.005E-6	80	0.031	0.225	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
18	PDB:3ai5A	0.119	0.233	1.442E-5	299	0.042	0.084	3ai5A.pdb.gz
19	PDB:3tixA	0.120	0.440	1.529E-5	153	0.020	0.078	3tixA.pdb.gz
20	PDB:6ef3u	0.121	0.868	1.621E-5	75	0.041	0.320	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A287B231	0.0	910	561	0.915	0.961	A0A287B231_PIG Ubiquilin 1 OS=Sus scrofa OX=9823 GN=UBQLN1 PE=1 SV=2
2	D4AA63	0.0	717	638	0.749	0.691	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
3	Q8R317	0.0	963	582	0.881	0.892	UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus OX=10090 GN=Ubqln1 PE=1 SV=1
4	Q99NB8	0.0	601	596	0.611	0.604	UBQL4_MOUSE Ubiquilin-4 OS=Mus musculus OX=10090 GN=Ubqln4 PE=1 SV=1
5	Q9JJP9	0.0	961	582	0.869	0.880	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
6	Q9NRR5	0.0	600	601	0.606	0.594	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
7	Q9QZM0	0.0	550	638	0.562	0.519	UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus OX=10090 GN=Ubqln2 PE=1 SV=2
8	Q9UHD9	0.0	758	624	0.798	0.753	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
9	Q9UMX0	0.0	1167	589	1.000	1.000	UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2
10	Q9VWD9	1.44e-177	515	547	0.470	0.506	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
11	Q9H347	9.50e-109	342	655	0.324	0.292	UBQL3_HUMAN Ubiquilin-3 OS=Homo sapiens OX=9606 GN=UBQLN3 PE=1 SV=2
12	G5EFF7	1.75e-108	336	502	0.358	0.420	UBQL_CAEEL Ubiquilin OS=Caenorhabditis elegans OX=6239 GN=ubql-1 PE=2 SV=1
13	Q9SII8	1.16e-73	247	551	0.341	0.365	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
14	Q9SII9	4.59e-62	216	538	0.353	0.387	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
15	Q9D4I8	1.85e-59	208	510	0.323	0.373	Q9D4I8_MOUSE Ubiquilin 5 OS=Mus musculus OX=10090 GN=Ubqln5 PE=1 SV=1
16	Q8IYU4	3.08e-58	204	475	0.285	0.354	UBQLN_HUMAN Ubiquilin-like protein OS=Homo sapiens OX=9606 GN=UBQLNL PE=1 SV=3
17	Q9NIF3	1.12e-40	157	523	0.177	0.199	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
18	P48510	3.58e-18	89.0	373	0.129	0.204	DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSK2 PE=1 SV=2
19	Q10169	3.22e-12	70.5	354	0.107	0.178	DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph1 PE=4 SV=1
20	O42967	6.54e-06	51.6	603	0.061	0.060	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02991 ATG8	5.4e+02	12.2	Autophagy protein Atg8 ubiquitin like
2	PF02845 CUE	2.4e+02	12.8	CUE domain
3	PF10302 Dsc3_N	29	16.6	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
4	PF16678 HOIP-UBA	4.2e+02	12.3	HOIP UBA domain pair
5	PF11976 Rad60-SLD	0.0032	28.5	Ubiquitin-2 like Rad60 SUMO-like
6	PF13881 Rad60-SLD_2	4	19.0	Ubiquitin-2 like Rad60 SUMO-like
7	PF17830 STI1	1e-05	36.6	STI1 domain
8	PF00627 UBA	0.00022	32.3	UBA/TS-N domain
9	PF00240 ubiquitin	1.5e-15	68.0	Ubiquitin family
10	PF18036 Ubiquitin_4	2.1e+02	13.4	Ubiquitin-like domain
11	PF18037 Ubiquitin_5	12	17.6	Ubiquitin-like domain
12	PF08817 YukD	3.5	19.7	WXG100 protein secretion system (Wss), protein YukD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365576

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357879	0.999	26S proteasome non-ATPase regulatory subunit 4
2	9606.ENSP00000343001	0.993	Ubiquitin conjugation factor E4 B
3	9606.ENSP00000360798	0.986	Epidermal growth factor receptor substrate 15
4	9606.ENSP00000037243	0.982	Gamma-aminobutyric acid receptor-associated protein-like 2
5	9606.ENSP00000351777	0.977	Transitional endoplasmic reticulum ATPase
6	9606.ENSP00000355361	0.977	Leukocyte surface antigen CD47
7	9606.ENSP00000467024	0.976	UV excision repair protein RAD23 homolog A
8	9606.ENSP00000306866	0.970	Gamma-aminobutyric acid receptor-associated protein
9	9606.ENSP00000441543	0.969	Polyubiquitin-C
10	9606.ENSP00000350708	0.949	UV excision repair protein RAD23 homolog B
11	9606.ENSP00000326366	0.946	Presenilin-1
12	9606.ENSP00000386541	0.940	26S proteasome non-ATPase regulatory subunit 14
13	9606.ENSP00000481878	0.935	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
14	9606.ENSP00000274545	0.931	Gamma-aminobutyric acid receptor subunit alpha-6
15	9606.ENSP00000393097	0.927	Gamma-aminobutyric acid receptor subunit alpha-1
16	9606.ENSP00000310129	0.926	26S proteasome non-ATPase regulatory subunit 2
17	9606.ENSP00000421828	0.924	Gamma-aminobutyric acid receptor subunit alpha-2
18	9606.ENSP00000359337	0.918	Gamma-aminobutyric acid receptor subunit alpha-3
19	9606.ENSP00000381293	0.916	Vesicle-fusing ATPase
20	9606.ENSP00000260442	0.914	Bcl-2-like protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.440	identical protein binding
GO:0031593	0.409	polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0080134	0.976	regulation of response to stress
GO:0048519	0.975	negative regulation of biological process
GO:0043170	0.968	macromolecule metabolic process
GO:0006807	0.958	nitrogen compound metabolic process
GO:0048523	0.943	negative regulation of cellular process
GO:0019538	0.928	protein metabolic process
GO:2000060	0.903	positive regulation of ubiquitin-dependent protein catabolic process
GO:0050896	0.902	response to stimulus
GO:0044260	0.902	cellular macromolecule metabolic process
GO:0010646	0.897	regulation of cell communication
GO:0023051	0.896	regulation of signaling
GO:0006508	0.893	proteolysis
GO:1901800	0.866	positive regulation of proteasomal protein catabolic process
GO:0051716	0.863	cellular response to stimulus
GO:0009966	0.862	regulation of signal transduction
GO:0051603	0.855	proteolysis involved in protein catabolic process
GO:0006511	0.840	ubiquitin-dependent protein catabolic process
GO:0006950	0.829	response to stress
GO:0042221	0.802	response to chemical
GO:0032101	0.799	regulation of response to external stimulus
GO:0010498	0.777	proteasomal protein catabolic process
GO:0036503	0.770	ERAD pathway
GO:0031347	0.761	regulation of defense response
GO:1905897	0.760	regulation of response to endoplasmic reticulum stress
GO:0043161	0.759	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0030433	0.748	ubiquitin-dependent ERAD pathway
GO:0032434	0.743	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0071840	0.678	cellular component organization or biogenesis
GO:1905898	0.656	positive regulation of response to endoplasmic reticulum stress
GO:0048585	0.648	negative regulation of response to stimulus
GO:0009968	0.624	negative regulation of signal transduction
GO:0002831	0.620	regulation of response to biotic stimulus
GO:0002682	0.616	regulation of immune system process
GO:0050776	0.578	regulation of immune response
GO:0045088	0.572	regulation of innate immune response
GO:0032879	0.543	regulation of localization
GO:0062207	0.490	regulation of pattern recognition receptor signaling pathway
GO:0016043	0.481	cellular component organization
GO:0050688	0.428	regulation of defense response to virus
GO:0051049	0.365	regulation of transport
GO:0065009	0.364	regulation of molecular function
GO:0051051	0.319	negative regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.997	nucleoplasm
GO:0032991	0.945	protein-containing complex
GO:0016020	0.926	membrane
GO:0005773	0.758	vacuole
GO:0071944	0.604	cell periphery
GO:0005776	0.526	autophagosome
GO:0005886	0.491	plasma membrane
GO:0012505	0.389	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]