StarFunc result for job id Q9UMX1

User Input

>input (484 residues)
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRR
GETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRL
SGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTAIIPHEL
IRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE
EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
SPLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q4V8C6	0.836	0.834	8.808E-97	485	0.975	0.973	Q4V8C6.pdb.gz	Q4V8C6_RAT Suppressor of fused homolog OS=Rattus norvegicus OX=10116 GN=Sufu PE=2 SV=1
2	AFDB:A0A0R4IN62	0.862	0.861	6.175E-87	485	0.816	0.814	A0A0R4IN62.pdb.gz
3	PDB:4blaD	0.738	0.487	1.336E-69	738	0.756	0.496	4blaD.pdb.gz
4	AFDB:Q27279	0.656	0.676	8.349E-50	468	0.349	0.361	Q27279.pdb.gz	Q27279_DROME Suppressor of fused homolog OS=Drosophila melanogaster OX=7227 GN=Su(fu) PE=2 SV=1
5	PDB:4kmaA	0.639	0.694	6.416E-48	440	0.353	0.389	4kmaA.pdb.gz
6	AFDB:Q7Z3T8	0.284	0.104	3.481E-5	1539	0.124	0.039	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
7	PDB:6h25D	0.087	0.153	2.950E-1	210	0.029	0.067	6h25D.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
8	PDB:7mq8NH	0.091	0.052	4.499E-1	1066	0.033	0.015	7mq8NH.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7meyB	0.088	0.203	6.082E-1	153	0.027	0.085	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
10	PDB:3q31A	0.090	0.148	6.460E-1	236	0.033	0.068	3q31A.pdb.gz	Structure of fungal alpha Carbonic Anhydrase from Aspergillus oryzae
11	PDB:6yxyEI	0.066	0.098	7.288E-1	275	0.043	0.076	6yxyEI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:2uxyA	0.076	0.085	8.733E-1	341	0.052	0.073	2uxyA.pdb.gz
13	PDB:3ptfA	0.098	0.250	1.112	153	0.027	0.085	3ptfA.pdb.gz
14	PDB:6d6qB	0.081	0.132	1.181	241	0.023	0.046	6d6qB.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
15	AFDB:Q8K2T8	0.075	0.069	3.941	535	0.074	0.067	Q8K2T8.pdb.gz	PAF1_MOUSE RNA polymerase II-associated factor 1 homolog OS=Mus musculus OX=10090 GN=Paf1 PE=1 SV=1
16	AFDB:P40022	0.058	0.125	5.327	185	0.025	0.065	P40022.pdb.gz	YEM4_YEAST Uncharacterized protein YER034W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YER034W PE=1 SV=1
17	AFDB:O96123	0.060	0.068	5.658	421	0.050	0.057	O96123.pdb.gz	O96123_PLAF7 Knob associated heat shock protein 40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201800 PE=4 SV=3
18	AFDB:D1MYR7	0.068	0.063	6.010	573	0.093	0.079	D1MYR7.pdb.gz	D1MYR7_9HYPO Polarity protein BemA OS=Epichloe festucae OX=35717 GN=BemA PE=1 SV=1
19	AFDB:Q6GQB5	0.052	0.101	6.010	181	0.039	0.105	Q6GQB5.pdb.gz	AKIR2_XENLA Akirin-2 OS=Xenopus laevis OX=8355 GN=akirin2.S PE=1 SV=1
20	AFDB:Q8II72	0.057	0.060	6.383	452	0.064	0.069	Q8II72.pdb.gz	Q8II72_PLAF7 Parasitophorous vacuolar protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1129100 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZN76	0.0	570	297	0.595	0.970	A0A8I5ZN76_RAT SUFU negative regulator of hedgehog signaling OS=Rattus norvegicus OX=10116 GN=Sufu PE=4 SV=1
2	A0A8I6A606	0.0	963	482	0.971	0.975	A0A8I6A606_RAT Suppressor of fused homolog OS=Rattus norvegicus OX=10116 GN=Sufu PE=3 SV=1
3	A9JRW8	0.0	823	472	0.810	0.831	A9JRW8_DANRE Suppressor of fused homolog OS=Danio rerio OX=7955 GN=Su(fu) PE=1 SV=1
4	F7FL48	0.0	871	461	0.868	0.911	F7FL48_RAT Suppressor of fused homolog OS=Rattus norvegicus OX=10116 GN=Sufu PE=3 SV=1
5	Q4V8C6	0.0	969	485	0.975	0.973	Q4V8C6_RAT Suppressor of fused homolog OS=Rattus norvegicus OX=10116 GN=Sufu PE=2 SV=1
6	Q7ZVZ9	0.0	814	485	0.808	0.806	Q7ZVZ9_DANRE Suppressor of fused homolog OS=Danio rerio OX=7955 GN=wu:fi39e05 PE=1 SV=1
7	Q8QG94	0.0	915	484	0.905	0.905	Q8QG94_CHICK Suppressor of fused homolog OS=Gallus gallus OX=9031 PE=2 SV=1
8	Q9UMX1	0.0	994	484	1.000	1.000	SUFU_HUMAN Suppressor of fused homolog OS=Homo sapiens OX=9606 GN=SUFU PE=1 SV=2
9	Q9Z0P7	0.0	974	484	0.977	0.977	SUFU_MOUSE Suppressor of fused homolog OS=Mus musculus OX=10090 GN=Sufu PE=1 SV=1
10	Q9VG38	1.01e-96	301	468	0.366	0.378	Q9VG38_DROME Suppressor of fused homolog OS=Drosophila melanogaster OX=7227 GN=Su(fu) PE=1 SV=1
11	Q27279	5.97e-96	299	468	0.364	0.376	Q27279_DROME Suppressor of fused homolog OS=Drosophila melanogaster OX=7227 GN=Su(fu) PE=2 SV=1
12	Q9UPM8	0.060	38.5	1137	0.060	0.026	AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens OX=9606 GN=AP4E1 PE=1 SV=2
13	Q9UT02	1.1	34.7	1811	0.050	0.013	SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec71 PE=1 SV=1
14	Q80V94	1.4	34.3	1122	0.066	0.029	AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus OX=10090 GN=Ap4e1 PE=1 SV=3
15	Q9LFA5	2.1	32.3	156	0.037	0.115	MED28_ARATH Mediator of RNA polymerase II transcription subunit 28 OS=Arabidopsis thaliana OX=3702 GN=MED28 PE=1 SV=1
16	Q7KLI1	3.4	32.7	1440	0.043	0.015	Q7KLI1_DROME Apaf-1 related killer DARK OS=Drosophila melanogaster OX=7227 GN=Dark PE=1 SV=1
17	P16110	6.5	31.6	264	0.050	0.091	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
18	Q3ZB97	7.1	32.0	951	0.060	0.030	Q3ZB97_RAT AP complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1
19	P08699	7.7	31.2	262	0.050	0.092	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4
20	Q9DBG3	8.0	31.6	937	0.060	0.031	AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus OX=10090 GN=Ap2b1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05076 SUFU	1.5e-46	170.0	Suppressor of fused protein (SUFU)
2	PF12470 SUFU_C	5.3e-79	276.7	Suppressor of Fused Gli/Ci N terminal binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228682	0.999	Zinc finger protein GLI1
2	9606.ENSP00000295709	0.999	Serine/threonine-protein kinase 36
3	9606.ENSP00000379258	0.999	Transcriptional activator GLI3
4	9606.ENSP00000390436	0.999	Zinc finger protein GLI2
5	9606.ENSP00000481842	0.994	Histone deacetylase complex subunit SAP18
6	9606.ENSP00000254301	0.992	Galectin-3
7	9606.ENSP00000249373	0.984	Smoothened homolog
8	9606.ENSP00000260570	0.981	Intraflagellar transport protein 172 homolog
9	9606.ENSP00000377934	0.980	Kinesin-like protein KIF7
10	9606.ENSP00000324806	0.973	Glycogen synthase kinase-3 beta
11	9606.ENSP00000359206	0.966	F-box/WD repeat-containing protein 1A
12	9606.ENSP00000385808	0.959	Kinesin-like protein KIF3A
13	9606.ENSP00000243344	0.958	Tetratricopeptide repeat protein 21B
14	9606.ENSP00000323580	0.958	Intraflagellar transport protein 88 homolog
15	9606.ENSP00000332353	0.958	Protein patched homolog 1
16	9606.ENSP00000264956	0.955	Ellis-van Creveld syndrome protein
17	9606.ENSP00000342144	0.952	Limbin
18	9606.ENSP00000249636	0.941	E3 SUMO-protein ligase PIAS1
19	9606.ENSP00000296266	0.935	Intraflagellar transport protein 122 homolog
20	9606.ENSP00000381167	0.935	Cytoplasmic dynein 2 heavy chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008270	0.946	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048523	0.945	negative regulation of cellular process
GO:0009966	0.935	regulation of signal transduction
GO:0032501	0.920	multicellular organismal process
GO:0048856	0.919	anatomical structure development
GO:0048585	0.909	negative regulation of response to stimulus
GO:0050896	0.907	response to stimulus
GO:0048518	0.902	positive regulation of biological process
GO:0009968	0.889	negative regulation of signal transduction
GO:0019222	0.883	regulation of metabolic process
GO:0030154	0.827	cell differentiation
GO:0060255	0.820	regulation of macromolecule metabolic process
GO:0080090	0.815	regulation of primary metabolic process
GO:0051171	0.803	regulation of nitrogen compound metabolic process
GO:0007165	0.798	signal transduction
GO:0048522	0.716	positive regulation of cellular process
GO:0000003	0.585	reproduction
GO:0048584	0.583	positive regulation of response to stimulus
GO:0031323	0.554	regulation of cellular metabolic process
GO:0010468	0.519	regulation of gene expression
GO:0048468	0.518	cell development
GO:0031326	0.512	regulation of cellular biosynthetic process
GO:0048515	0.487	spermatid differentiation
GO:0007286	0.476	spermatid development
GO:0019219	0.472	regulation of nucleobase-containing compound metabolic process
GO:0008589	0.440	regulation of smoothened signaling pathway
GO:0010556	0.436	regulation of macromolecule biosynthetic process
GO:0051252	0.405	regulation of RNA metabolic process
GO:0006355	0.381	regulation of DNA-templated transcription
GO:0051246	0.363	regulation of protein metabolic process
GO:0009893	0.331	positive regulation of metabolic process
GO:0065009	0.321	regulation of molecular function
GO:0045879	0.319	negative regulation of smoothened signaling pathway
GO:0009892	0.306	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.998	cytosol
GO:0032991	0.996	protein-containing complex
GO:0005929	0.973	cilium
GO:0140535	0.938	intracellular protein-containing complex
GO:0005654	0.938	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]