StarFunc result for job id Q9UMX2

User Input

>input (235 residues)
MPCKRCRPSVYSLSYIKRGKTRNYLYPIWSPYAYYLYCYKYRITLREKMLPRCYKSITYK
EEEDLTLQPRSCLQCSESLVGLQEGKSTEQGNHDQLKELYSAGNLTVLATDPLLHQDPVQ
LDFHFRLTSQTSAHWHGLLCDRRLFLDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVN
FQNDRNDRGALLRAFSYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8MW57	0.834	0.834	1.774E-42	235	0.996	0.996	A8MW57.pdb.gz	A8MW57_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
2	AFDB:A1BPI0	0.622	0.602	5.312E-32	243	0.821	0.794	A1BPI0.pdb.gz	OAZ3_RAT Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1
3	AFDB:O08608	0.540	0.663	2.078E-14	189	0.260	0.323	O08608.pdb.gz	OAZ2_MOUSE Ornithine decarboxylase antizyme 2 OS=Mus musculus OX=10090 GN=Oaz2 PE=1 SV=2
4	AFDB:P54369	0.545	0.564	2.924E-14	227	0.230	0.238	P54369.pdb.gz	OAZ1_MOUSE Ornithine decarboxylase antizyme 1 OS=Mus musculus OX=10090 GN=Oaz1 PE=1 SV=3
5	AFDB:P54368	0.551	0.567	9.656E-14	228	0.234	0.241	P54368.pdb.gz	OAZ1_HUMAN Ornithine decarboxylase antizyme 1 OS=Homo sapiens OX=9606 GN=OAZ1 PE=1 SV=3
6	AFDB:P54361	0.448	0.416	7.118E-9	254	0.196	0.181	P54361.pdb.gz	OAZ_DROME Ornithine decarboxylase antizyme OS=Drosophila melanogaster OX=7227 GN=Oda PE=2 SV=2
7	AFDB:Q9USQ5	0.358	0.371	5.390E-5	226	0.106	0.111	Q9USQ5.pdb.gz	OAZ_SCHPO Ornithine decarboxylase antizyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spa1 PE=1 SV=2
8	AFDB:P0A944	0.335	0.506	5.247E-4	148	0.085	0.135	P0A944.pdb.gz	RIMI_ECOLI [Ribosomal protein bS18]-alanine N-acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rimI PE=1 SV=1
9	PDB:5isvA	0.358	0.517	9.424E-4	156	0.085	0.128	5isvA.pdb.gz
10	PDB:2g3aA	0.323	0.519	1.665E-3	137	0.077	0.131	2g3aA.pdb.gz
11	PDB:4avaA	0.249	0.189	1.665E-3	327	0.072	0.052	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
12	AFDB:Q9UHE5	0.292	0.301	2.732E-3	227	0.060	0.062	Q9UHE5.pdb.gz	NAT8_HUMAN N-acetyltransferase 8 OS=Homo sapiens OX=9606 GN=NAT8 PE=1 SV=2
13	PDB:5c88A	0.258	0.366	4.379E-3	158	0.051	0.076	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
14	PDB:1tiqA	0.322	0.422	5.194E-3	173	0.064	0.087	1tiqA.pdb.gz	Structural and functional evidence for Bacillus subtilis PaiA as a novel N1-spermidine/spermine acetyltransferase.
15	PDB:2ob0C	0.276	0.375	5.194E-3	166	0.072	0.102	2ob0C.pdb.gz	Structure of Human MAK3 homolog
16	PDB:3owcA	0.332	0.437	5.194E-3	172	0.102	0.140	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
17	AFDB:Q9LFD8	0.268	0.235	5.724E-3	273	0.089	0.077	Q9LFD8.pdb.gz	Q9LFD8_ARATH histone acetyltransferase OS=Arabidopsis thaliana OX=3702 GN=At5g16800 PE=1 SV=1
18	PDB:2z0zA	0.318	0.376	6.903E-3	194	0.081	0.098	2z0zA.pdb.gz
19	PDB:3dr8A	0.286	0.374	9.175E-3	173	0.077	0.104	3dr8A.pdb.gz	Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
20	PDB:6e1xC	0.307	0.388	1.088E-2	176	0.060	0.080	6e1xC.pdb.gz	Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMX2	7.19e-178	489	235	1.000	1.000	OAZ3_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
2	A8MW57	3.30e-177	487	235	0.996	0.996	A8MW57_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
3	Q9R109	1.73e-144	405	243	0.864	0.835	OAZ3_MOUSE Ornithine decarboxylase antizyme 3 OS=Mus musculus OX=10090 GN=Oaz3 PE=1 SV=2
4	A0A0G2JH29	9.83e-132	370	190	0.762	0.942	A0A0G2JH29_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=1
5	H0Y7Y4	1.03e-131	371	203	0.762	0.882	H0Y7Y4_HUMAN Ornithine decarboxylase antizyme 3 OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
6	A1BPI0	5.22e-130	368	243	0.830	0.802	OAZ3_RAT Ornithine decarboxylase antizyme 3 OS=Rattus norvegicus OX=10116 GN=Oaz3 PE=1 SV=1
7	J3QLT2	9.99e-82	241	123	0.519	0.992	J3QLT2_HUMAN Ornithine decarboxylase antizyme 3 (Fragment) OS=Homo sapiens OX=9606 GN=OAZ3 PE=1 SV=2
8	O08608	4.36e-28	107	189	0.217	0.270	OAZ2_MOUSE Ornithine decarboxylase antizyme 2 OS=Mus musculus OX=10090 GN=Oaz2 PE=1 SV=2
9	O95190	5.29e-28	107	189	0.217	0.270	OAZ2_HUMAN Ornithine decarboxylase antizyme 2 OS=Homo sapiens OX=9606 GN=OAZ2 PE=1 SV=1
10	P54368	2.90e-25	100	228	0.238	0.246	OAZ1_HUMAN Ornithine decarboxylase antizyme 1 OS=Homo sapiens OX=9606 GN=OAZ1 PE=1 SV=3
11	P54369	5.01e-25	100	227	0.238	0.247	OAZ1_MOUSE Ornithine decarboxylase antizyme 1 OS=Mus musculus OX=10090 GN=Oaz1 PE=1 SV=3
12	P54370	1.08e-24	99.4	227	0.238	0.247	OAZ1_RAT Ornithine decarboxylase antizyme 1 OS=Rattus norvegicus OX=10116 GN=Oaz1 PE=1 SV=3
13	P54361	1.56e-10	61.6	254	0.132	0.122	OAZ_DROME Ornithine decarboxylase antizyme OS=Drosophila melanogaster OX=7227 GN=Oda PE=2 SV=2
14	P35197	0.61	33.5	352	0.170	0.114	GCS1_YEAST ADP-ribosylation factor GTPase-activating protein GCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCS1 PE=1 SV=1
15	Q8YZ70	8.4	29.6	188	0.072	0.090	CPCS1_NOSS1 Phycocyanobilin lyase CpcS 1 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=cpcS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07732 Cu-oxidase_3	3.8e+02	12.5	Multicopper oxidase
2	PF02100 ODC_AZ	4.2e-12	57.5	Ornithine decarboxylase antizyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.NP_001288344.1

Rank	PPI partner	STRING score	Description
1	9597.NP_001280647.1	0.876	Belongs to the Orn/Lys/Arg decarboxylase class-II family.
2	9597.XP_003822134.1	0.860	Belongs to the spermidine/spermine synthase family.
3	9597.XP_008968234.1	0.860	Belongs to the spermidine/spermine synthase family.
4	9597.XP_003821774.1	0.840	Belongs to the Orn/Lys/Arg decarboxylase class-II family.
5	9597.XP_003827008.1	0.840	Belongs to the Orn/Lys/Arg decarboxylase class-II family.
6	9597.XP_003812324.1	0.740	Gametogenetin
7	9597.XP_003815226.1	0.738	Belongs to the AAA ATPase family.
8	9597.XP_008955262.1	0.728	Proteasome subunit alpha 3
9	9597.XP_008955033.1	0.682	Proteasome 26S subunit, non-ATPase 3
10	9597.NP_001276650.1	0.681	Ornithine decarboxylase antizyme 1
11	9597.NP_001276924.1	0.671	Ornithine decarboxylase antizyme 2
12	9597.XP_008976200.1	0.650	Solute carrier family 22 member 16
13	9597.XP_003808610.1	0.649	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 71% coverage of the annotated genomic feature by RNAseq alignments
14	9597.XP_003831757.1	0.649	Proteasome 26S subunit, ATPase 6
15	9597.XP_003821710.1	0.641	Proteasome subunit beta 1
16	9597.XP_003808168.1	0.640	Proteasome subunit beta type-11
17	9597.XP_003809892.1	0.640	Proteasome subunit beta 3
18	9597.XP_003808115.1	0.639	Proteasome subunit beta 7
19	9597.XP_003812544.1	0.639	Proteasome 26S subunit, ATPase 4
20	9597.XP_003806068.1	0.638	Proteasome 26S subunit, non-ATPase 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004857	1.000	enzyme inhibitor activity
GO:0042979	0.973	ornithine decarboxylase regulator activity
GO:0008073	0.946	ornithine decarboxylase inhibitor activity
GO:0019904	0.335	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.976	regulation of metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0050794	0.964	regulation of cellular process
GO:0071704	0.942	organic substance metabolic process
GO:0006807	0.930	nitrogen compound metabolic process
GO:1901564	0.892	organonitrogen compound metabolic process
GO:0048518	0.867	positive regulation of biological process
GO:0032502	0.866	developmental process
GO:0048232	0.866	male gamete generation
GO:0009894	0.861	regulation of catabolic process
GO:0051246	0.853	regulation of protein metabolic process
GO:0048522	0.810	positive regulation of cellular process
GO:0009987	0.794	cellular process
GO:0007283	0.767	spermatogenesis
GO:0048519	0.669	negative regulation of biological process
GO:0031323	0.651	regulation of cellular metabolic process
GO:0048523	0.633	negative regulation of cellular process
GO:0042176	0.428	regulation of protein catabolic process
GO:0044237	0.397	cellular metabolic process
GO:0044238	0.354	primary metabolic process
GO:0050896	0.342	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.925	cytoplasm
GO:0005829	0.881	cytosol
GO:0005576	0.811	extracellular region
GO:0032991	0.533	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]