StarFunc result for job id Q9UMX3

User Input

>input (212 residues)
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVP
GRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW
GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVS
TDPGLRSHWLVAALCSFGRFLKAAFFVLLPER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35425	0.816	0.812	1.036E-26	213	0.958	0.953	O35425.pdb.gz	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
2	AFDB:Q9NGX3	0.726	0.501	1.798E-10	313	0.288	0.195	Q9NGX3.pdb.gz	Q9NGX3_DROME Bcl-2-like protein BUFFY (Fragment) OS=Drosophila melanogaster OX=7227 GN=Buffy PE=2 SV=1
3	AFDB:Q7KM33	0.706	0.471	2.581E-9	325	0.288	0.188	Q7KM33.pdb.gz	Q7KM33_DROME Bcl-2 family member protein OS=Drosophila melanogaster OX=7227 GN=Debcl PE=2 SV=1
4	AFDB:Q95U83	0.626	0.430	4.929E-8	317	0.302	0.202	Q95U83.pdb.gz	Q95U83_DROME BOK OS=Drosophila melanogaster OX=7227 GN=Debcl PE=2 SV=1
5	AFDB:P53563	0.606	0.554	1.515E-6	233	0.193	0.176	P53563.pdb.gz	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
6	AFDB:Q00709	0.606	0.554	2.556E-6	233	0.208	0.189	Q00709.pdb.gz	BCL2_CHICK Apoptosis regulator Bcl-2 OS=Gallus gallus OX=9031 GN=BCL2 PE=2 SV=1
7	AFDB:A0A024R2B3	0.588	0.524	3.401E-6	239	0.212	0.188	A0A024R2B3.pdb.gz
8	AFDB:Q564A4	0.606	0.565	4.314E-6	228	0.184	0.171	Q564A4.pdb.gz	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
9	AFDB:O08734	0.610	0.618	4.525E-6	209	0.203	0.206	O08734.pdb.gz	BAK_MOUSE Bcl-2 homologous antagonist/killer OS=Mus musculus OX=10090 GN=Bak1 PE=1 SV=3
10	AFDB:Q90Z98	0.606	0.542	6.312E-6	238	0.175	0.155	Q90Z98.pdb.gz	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
11	PDB:4wmuA	0.588	0.256	1.035E-4	516	0.165	0.068	4wmuA.pdb.gz	A Maltose-Binding Protein Fusion Construct Yields a Robust Crystallography Platform for MCL1.
12	PDB:1bxlA	0.603	0.697	1.253E-4	181	0.160	0.188	1bxlA.pdb.gz	Structure of Bcl-xL-Bak peptide complex: recognition between regulators of apoptosis.
13	PDB:2k7wA	0.549	0.600	1.922E-4	192	0.198	0.219	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
14	PDB:5w62A	0.504	0.668	2.812E-4	156	0.160	0.218	5w62A.pdb.gz
15	PDB:1lxlA	0.557	0.536	4.977E-4	221	0.165	0.158	1lxlA.pdb.gz
16	PDB:2b48A	0.399	0.574	1.117E-3	143	0.156	0.231	2b48A.pdb.gz
17	PDB:1o0lA	0.533	0.595	3.182E-3	188	0.160	0.181	1o0lA.pdb.gz
18	PDB:4hnjB	0.356	0.562	4.440E-3	130	0.146	0.238	4hnjB.pdb.gz	PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis.
19	PDB:7cclC	0.379	0.503	1.850E-2	147	0.123	0.177	7cclC.pdb.gz
20	PDB:1ddbA	0.368	0.391	6.253E-1	195	0.123	0.133	1ddbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMX3	3.16e-153	425	212	1.000	1.000	BOK_HUMAN Bcl-2-related ovarian killer protein OS=Homo sapiens OX=9606 GN=BOK PE=1 SV=1
2	O35425	6.68e-146	406	213	0.958	0.953	BOK_MOUSE Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1
3	Q792S6	6.68e-146	406	213	0.958	0.953	BOK_RAT Bcl-2-related ovarian killer protein OS=Rattus norvegicus OX=10116 GN=Bok PE=1 SV=1
4	Q9UL32	5.38e-143	399	213	0.943	0.939	Q9UL32_HUMAN Bcl-2 related ovarian killer OS=Homo sapiens OX=9606 GN=BOK PE=2 SV=1
5	Q9V9C8	4.71e-24	98.6	300	0.269	0.190	Q9V9C8_DROME BG1 OS=Drosophila melanogaster OX=7227 GN=Debcl PE=2 SV=2
6	Q7KM33	5.23e-24	99.0	325	0.283	0.185	Q7KM33_DROME Bcl-2 family member protein OS=Drosophila melanogaster OX=7227 GN=Debcl PE=2 SV=1
7	Q7KJ42	4.56e-23	94.4	214	0.264	0.262	Q7KJ42_DROME Pro-apoptotic Bcl-2/Bax-like protein OS=Drosophila melanogaster OX=7227 GN=Debcl PE=2 SV=1
8	Q8T8Y5	8.79e-23	95.1	299	0.269	0.191	Q8T8Y5_DROME AT16536p OS=Drosophila melanogaster OX=7227 GN=Buffy PE=2 SV=1
9	Q9NGX3	9.09e-23	95.5	313	0.269	0.182	Q9NGX3_DROME Bcl-2-like protein BUFFY (Fragment) OS=Drosophila melanogaster OX=7227 GN=Buffy PE=2 SV=1
10	Q95U83	4.01e-19	85.5	317	0.250	0.167	Q95U83_DROME BOK OS=Drosophila melanogaster OX=7227 GN=Debcl PE=2 SV=1
11	Q90Z98	4.77e-12	65.1	238	0.146	0.130	Q90Z98_DANRE BCL2-like 1 OS=Danio rerio OX=7955 GN=bcl2l PE=1 SV=1
12	P53563	1.35e-09	58.2	233	0.127	0.116	B2CL1_RAT Bcl-2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Bcl2l1 PE=1 SV=2
13	Q64373	1.35e-09	58.2	233	0.127	0.116	B2CL1_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
14	Q07812	1.53e-09	57.4	192	0.217	0.240	BAX_HUMAN Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX PE=1 SV=1
15	Q564A4	1.76e-09	57.8	228	0.118	0.110	Q564A4_DANRE B-cell leukemia/lymphoma 2 OS=Danio rerio OX=7955 GN=bcl2 PE=2 SV=1
16	O35843	1.90e-09	57.8	235	0.127	0.115	O35843_MOUSE Bcl-2-like protein 1 OS=Mus musculus OX=10090 GN=Bcl2l1 PE=1 SV=1
17	Q07817	2.51e-09	57.4	233	0.127	0.116	B2CL1_HUMAN Bcl-2-like protein 1 OS=Homo sapiens OX=9606 GN=BCL2L1 PE=1 SV=1
18	Q9I9N4	2.76e-09	56.6	192	0.217	0.240	Q9I9N4_DANRE BCL2-associated X, apoptosis regulator a OS=Danio rerio OX=7955 GN=bax PE=2 SV=1
19	A0A0D9S330	8.09e-09	55.5	192	0.226	0.250	A0A0D9S330_CHLSB BCL2 associated X, apoptosis regulator OS=Chlorocebus sabaeus OX=60711 GN=BAX PE=3 SV=1
20	O88996	1.36e-08	54.7	193	0.151	0.166	O88996_RAT BCL-W OS=Rattus norvegicus OX=10116 GN=Bcl2l2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00452 Bcl-2	2.6e-19	81.1	Apoptosis regulator proteins, Bcl-2 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375292.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354239.1	0.896	Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP.
2	61622.XP_010375394.1	0.793	BCL2 associated agonist of cell death
3	61622.XP_010379373.1	0.793	Counters the protective effect of Bcl-2.
4	61622.XP_010369508.1	0.777	Bcl-2-interacting killer
5	61622.XP_010385556.1	0.777	BCL2 family apoptosis regulator
6	61622.XP_010384652.1	0.765	Induces apoptosis and anoikis.
7	61622.XP_010358083.1	0.720	Bcl-2-modifying factor isoform X1
8	61622.XP_010375191.1	0.716	Phorbol-12-myristate-13-acetate-induced protein 1
9	61622.XP_010383766.1	0.702	t-SNARE domain-containing protein 1
10	61622.XP_010368668.1	0.700	RNA polymerase II associated protein 2
11	61622.XP_010360689.1	0.690	Acts as a tumor suppressor in many tumor types
12	61622.XP_010366649.1	0.615	Diablo homolog, mitochondrial isoform X1
13	61622.XP_010367792.1	0.615	BCL2 like 12
14	61622.XP_010381184.1	0.615	Tripartite motif-containing protein 2 isoform X1
15	61622.XP_010361523.1	0.569	Belongs to the peptidase C14A family.
16	61622.XP_010360822.1	0.552	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
17	61622.XP_010377697.1	0.524	Belongs to the peptidase C14A family.
18	61622.XP_010374228.1	0.517	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.
19	61622.XP_010383921.1	0.517	Cytochrome c
20	61622.XP_010386658.1	0.517	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046983	0.966	protein dimerization activity
GO:0042802	0.963	identical protein binding
GO:0019899	0.873	enzyme binding
GO:0031625	0.639	ubiquitin protein ligase binding
GO:0042803	0.608	protein homodimerization activity
GO:0005102	0.513	signaling receptor binding
GO:0019904	0.458	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0010941	0.985	regulation of cell death
GO:0006915	0.981	apoptotic process
GO:0048522	0.975	positive regulation of cellular process
GO:0042981	0.969	regulation of apoptotic process
GO:0050896	0.954	response to stimulus
GO:0006919	0.945	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043065	0.938	positive regulation of apoptotic process
GO:0007005	0.932	mitochondrion organization
GO:0051716	0.927	cellular response to stimulus
GO:0097193	0.916	intrinsic apoptotic signaling pathway
GO:0032501	0.852	multicellular organismal process
GO:0008637	0.843	apoptotic mitochondrial changes
GO:0043066	0.840	negative regulation of apoptotic process
GO:0031323	0.831	regulation of cellular metabolic process
GO:0032502	0.769	developmental process
GO:2001233	0.737	regulation of apoptotic signaling pathway
GO:0009894	0.640	regulation of catabolic process
GO:0048869	0.597	cellular developmental process
GO:0048856	0.589	anatomical structure development
GO:0072331	0.565	signal transduction by p53 class mediator
GO:0048584	0.551	positive regulation of response to stimulus
GO:0010821	0.490	regulation of mitochondrion organization
GO:0006950	0.431	response to stress
GO:0023056	0.405	positive regulation of signaling
GO:0010647	0.405	positive regulation of cell communication
GO:0009967	0.402	positive regulation of signal transduction
GO:0008152	0.386	metabolic process
GO:1902533	0.373	positive regulation of intracellular signal transduction
GO:0051179	0.365	localization
GO:0007275	0.347	multicellular organism development
GO:0051130	0.344	positive regulation of cellular component organization
GO:0080134	0.306	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0012505	0.993	endomembrane system
GO:0016020	0.991	membrane
GO:0032991	0.922	protein-containing complex
GO:0031967	0.915	organelle envelope
GO:0005634	0.901	nucleus
GO:0031090	0.897	organelle membrane
GO:0005829	0.883	cytosol
GO:0031966	0.878	mitochondrial membrane
GO:0005783	0.705	endoplasmic reticulum
GO:0098588	0.622	bounding membrane of organelle
GO:0031984	0.547	organelle subcompartment
GO:0005794	0.461	Golgi apparatus
GO:0042175	0.417	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.410	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]