StarFunc result for job id Q9UMY1

User Input

>input (257 residues)
MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFD
DEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILE
KLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQ
DLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQN
AKRFKRRWMVRKMKTKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZW2	0.313	0.313	7.338E-36	257	1.000	1.000	A0A024QZW2.pdb.gz
2	PDB:7mq8ND	0.119	0.319	4.258E-10	84	0.323	0.988	7mq8ND.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:P17861	0.202	0.199	1.248E-1	261	0.148	0.146	P17861.pdb.gz	XBP1_HUMAN X-box-binding protein 1 OS=Homo sapiens OX=9606 GN=XBP1 PE=1 SV=2
4	AFDB:P32909	0.171	0.079	2.023E-1	740	0.171	0.059	P32909.pdb.gz	SMY2_YEAST Protein SMY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMY2 PE=1 SV=2
5	AFDB:Q558Z2	0.169	0.056	2.023E-1	905	0.121	0.034	Q558Z2.pdb.gz	SUN1_DICDI Sun domain-containing protein 1 OS=Dictyostelium discoideum OX=44689 GN=sun1 PE=1 SV=1
6	AFDB:Q9I7R7	0.203	0.153	2.023E-1	362	0.121	0.086	Q9I7R7.pdb.gz	Q9I7R7_DROME GH15549p OS=Drosophila melanogaster OX=7227 GN=CG1809 PE=2 SV=1
7	AFDB:P42698	0.143	0.107	2.322E-1	387	0.132	0.088	P42698.pdb.gz	DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DRT111 PE=1 SV=2
8	AFDB:A0A0N9NCT8	0.145	0.127	3.279E-1	306	0.132	0.111	A0A0N9NCT8.pdb.gz	A0A0N9NCT8_YERPU YopD protein OS=Yersinia pseudotuberculosis OX=633 PE=4 SV=1
9	AFDB:P34478	0.111	0.054	5.316E-1	691	0.128	0.048	P34478.pdb.gz	GEI13_CAEEL Gex-3-interacting protein 13 OS=Caenorhabditis elegans OX=6239 GN=gei-13 PE=1 SV=2
10	AFDB:Q8UVQ5	0.209	0.205	6.103E-1	263	0.136	0.133	Q8UVQ5.pdb.gz
11	AFDB:A2BEV6	0.164	0.059	7.006E-1	861	0.179	0.053	A2BEV6.pdb.gz	A2BEV6_DANRE Nexilin OS=Danio rerio OX=7955 GN=CH211-232D19.9 PE=4 SV=2
12	PDB:2lfwB	0.086	0.264	6.172	62	0.070	0.290	2lfwB.pdb.gz
13	PDB:6hivCb	0.079	0.080	9.339	252	0.039	0.040	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:7ajtJM	0.096	0.157	9.339	135	0.066	0.126	7ajtJM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMY1	0.0	519	257	1.000	1.000	NOL7_HUMAN Nucleolar protein 7 OS=Homo sapiens OX=9606 GN=NOL7 PE=1 SV=2
2	M9PDL4	0.88	33.5	1068	0.101	0.024	M9PDL4_DROME Multiple wing hairs, isoform B OS=Drosophila melanogaster OX=7227 GN=mwh PE=4 SV=1
3	M9PE53	0.92	33.5	1069	0.101	0.024	M9PE53_DROME Multiple wing hairs, isoform C OS=Drosophila melanogaster OX=7227 GN=mwh PE=4 SV=1
4	Q9W0J2	1.3	32.7	836	0.101	0.031	Q9W0J2_DROME Multiple wing hairs, isoform A OS=Drosophila melanogaster OX=7227 GN=mwh PE=2 SV=1
5	Q6VNB8	2.4	32.0	3508	0.086	0.006	WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus OX=10090 GN=Wdfy3 PE=1 SV=1
6	O74509	8.4	30.0	341	0.097	0.073	VAM7_SCHPO Vacuolar morphogenesis protein 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC594.06c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08157 NUC129	1.7e-27	106.8	NUC129 domain
2	PF05764 YL1	42	15.7	YL1 nuclear protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364320	0.917	mRNA turnover protein 4 homolog
2	9606.ENSP00000293362	0.912	Proteasome activator complex subunit 3
3	9606.ENSP00000261708	0.899	U3 small nucleolar RNA-associated protein 6 homolog
4	9606.ENSP00000362105	0.895	Probable U3 small nucleolar RNA-associated protein 11
5	9606.ENSP00000418221	0.883	Ribosomal protein L7 like 1
6	9606.ENSP00000429986	0.847	Transcription and mRNA export factor ENY2
7	9606.ENSP00000480832	0.847	NOP16 nucleolar protein
8	9606.ENSP00000261015	0.840	Ribosome biogenesis protein WDR12
9	9606.ENSP00000285814	0.840	Nucleolar protein interacting with the FHA domain of MKI67
10	9606.ENSP00000254940	0.834	60S ribosome subunit biogenesis protein NIP7 homolog
11	9606.ENSP00000259239	0.827	U3 small nucleolar ribonucleoprotein protein IMP4
12	9606.ENSP00000315476	0.820	Exosome complex component RRP41
13	9606.ENSP00000367029	0.814	DNA-directed RNA polymerase I subunit RPA49
14	9606.ENSP00000367623	0.787	Heat shock 70 kDa protein 14
15	9606.ENSP00000244230	0.778	U3 small nucleolar ribonucleoprotein protein MPP10
16	9606.ENSP00000358563	0.765	H/ACA ribonucleoprotein complex subunit 4
17	9606.ENSP00000331111	0.740	DNA-directed RNA polymerase I subunit RPA12
18	9606.ENSP00000472985	0.730	Ribosomal protein S5
19	9606.ENSP00000327179	0.726	U3 small nucleolar RNA-associated protein 4 homolog
20	9606.ENSP00000322396	0.721	Ribosome biogenesis regulatory protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.981	regulation of biological process
GO:0071704	0.969	organic substance metabolic process
GO:0044238	0.963	primary metabolic process
GO:0050794	0.952	regulation of cellular process
GO:0071840	0.945	cellular component organization or biogenesis
GO:0044237	0.941	cellular metabolic process
GO:0022613	0.888	ribonucleoprotein complex biogenesis
GO:0006807	0.869	nitrogen compound metabolic process
GO:0043170	0.856	macromolecule metabolic process
GO:0034641	0.711	cellular nitrogen compound metabolic process
GO:0006139	0.668	nucleobase-containing compound metabolic process
GO:0090304	0.633	nucleic acid metabolic process
GO:0010467	0.544	gene expression
GO:0016070	0.526	RNA metabolic process
GO:0048518	0.367	positive regulation of biological process
GO:0019222	0.302	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005739	1.000	mitochondrion
GO:0005730	1.000	nucleolus
GO:0005654	0.948	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]