StarFunc result for job id Q9UMY4

User Input

>input (162 residues)
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UMY4	1.000	1.000	4.353E-32	162	1.000	1.000	Q9UMY4.pdb.gz	SNX12_HUMAN Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 PE=1 SV=4
2	AFDB:Q3B7E7	0.949	0.949	2.729E-27	162	0.790	0.790	Q3B7E7.pdb.gz	Q3B7E7_DANRE Sorting nexin-3 OS=Danio rerio OX=7955 GN=wu:fb53a08 PE=1 SV=1
3	AFDB:Q9VG51	0.901	0.875	3.397E-26	167	0.772	0.749	Q9VG51.pdb.gz	Q9VG51_DROME RE52028p OS=Drosophila melanogaster OX=7227 GN=Snx3 PE=1 SV=1
4	AFDB:O60493	0.871	0.871	3.830E-26	162	0.790	0.790	O60493.pdb.gz	SNX3_HUMAN Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3 PE=1 SV=3
5	AFDB:Q9XW41	0.903	0.903	2.319E-25	162	0.698	0.698	Q9XW41.pdb.gz	Q9XW41_CAEEL PX domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snx-3 PE=1 SV=1
6	PDB:2mxcA	0.743	0.702	2.208E-20	172	0.778	0.733	2mxcA.pdb.gz
7	AFDB:O94291	0.779	0.877	3.416E-15	143	0.414	0.469	O94291.pdb.gz	SNX3_SCHPO Sorting nexin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx3 PE=3 SV=1
8	AFDB:C8VAL9	0.760	0.864	1.443E-14	142	0.426	0.486	C8VAL9.pdb.gz	C8VAL9_EMENI Sorting nexin-3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10594 PE=3 SV=1
9	AFDB:Q08826	0.728	0.728	8.056E-13	162	0.370	0.370	Q08826.pdb.gz	SNX3_YEAST Sorting nexin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNX3 PE=1 SV=1
10	AFDB:Q9FG38	0.675	0.281	5.501E-12	402	0.315	0.127	Q9FG38.pdb.gz	SNX1_ARATH Sorting nexin 1 OS=Arabidopsis thaliana OX=3702 GN=SNX1 PE=1 SV=1
11	AFDB:A0A0R4IIY5	0.647	0.251	1.131E-11	435	0.296	0.110	A0A0R4IIY5.pdb.gz	A0A0R4IIY5_DANRE Sorting nexin-7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
12	PDB:1ocuA	0.656	0.784	4.763E-11	134	0.352	0.425	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
13	PDB:4pzgA	0.619	0.658	2.451E-8	152	0.235	0.250	4pzgA.pdb.gz
14	PDB:6q0xA	0.595	0.273	7.640E-5	373	0.222	0.097	6q0xA.pdb.gz
15	PDB:7d6dA	0.553	0.262	1.235E-4	380	0.241	0.103	7d6dA.pdb.gz
16	PDB:2dybA	0.535	0.305	7.942E-4	298	0.130	0.070	2dybA.pdb.gz
17	PDB:6wxuB	0.136	0.095	2.112E-1	273	0.093	0.055	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.
18	PDB:3k81D	0.139	0.193	2.851E-1	106	0.043	0.066	3k81D.pdb.gz
19	PDB:1g9qA	0.185	0.150	3.849E-1	205	0.099	0.078	1g9qA.pdb.gz	The structure of ADP-ribose pyrophosphatase reveals the structural basis for the versatility of the Nudix family.
20	PDB:2ygkA	0.193	0.114	4.340E-1	319	0.099	0.050	2ygkA.pdb.gz	Structural and Functional Insights Into DNA-End Processing by the Archaeal Hera Helicase-Nura Nuclease Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UMY4	1.11e-119	336	162	1.000	1.000	SNX12_HUMAN Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 PE=1 SV=4
2	Q3B7E7	1.04e-97	280	162	0.784	0.784	Q3B7E7_DANRE Sorting nexin-3 OS=Danio rerio OX=7955 GN=wu:fb53a08 PE=1 SV=1
3	O60493	1.30e-96	278	162	0.790	0.790	SNX3_HUMAN Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3 PE=1 SV=3
4	O70492	1.76e-95	275	162	0.778	0.778	SNX3_MOUSE Sorting nexin-3 OS=Mus musculus OX=10090 GN=Snx3 PE=1 SV=3
5	Q9VG51	1.40e-91	265	167	0.772	0.749	Q9VG51_DROME RE52028p OS=Drosophila melanogaster OX=7227 GN=Snx3 PE=1 SV=1
6	Q9XW41	8.35e-82	240	162	0.679	0.679	Q9XW41_CAEEL PX domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snx-3 PE=1 SV=1
7	C8VAL9	1.76e-40	135	142	0.420	0.479	C8VAL9_EMENI Sorting nexin-3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10594 PE=3 SV=1
8	O94291	4.98e-37	126	143	0.414	0.469	SNX3_SCHPO Sorting nexin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx3 PE=3 SV=1
9	Q08826	1.56e-23	92.4	162	0.358	0.358	SNX3_YEAST Sorting nexin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNX3 PE=1 SV=1
10	Q9FG38	1.06e-19	86.3	402	0.321	0.129	SNX1_ARATH Sorting nexin 1 OS=Arabidopsis thaliana OX=3702 GN=SNX1 PE=1 SV=1
11	Q9Y5W9	1.74e-16	76.3	270	0.253	0.152	SNX11_HUMAN Sorting nexin-11 OS=Homo sapiens OX=9606 GN=SNX11 PE=1 SV=2
12	Q6GMJ0	3.62e-15	73.6	413	0.315	0.123	Q6GMJ0_DANRE Zgc:92458 OS=Danio rerio OX=7955 GN=zgc:92458 PE=2 SV=1
13	A0A0R4IIY5	3.81e-15	73.6	435	0.315	0.117	A0A0R4IIY5_DANRE Sorting nexin-7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
14	A0A0R4IBS8	4.39e-15	73.6	469	0.315	0.109	A0A0R4IBS8_DANRE Sorting nexin 7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1
15	Q13596	7.39e-15	73.2	522	0.290	0.090	SNX1_HUMAN Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1 PE=1 SV=3
16	Q9CY18	1.21e-14	72.0	387	0.278	0.116	SNX7_MOUSE Sorting nexin-7 OS=Mus musculus OX=10090 GN=Snx7 PE=1 SV=1
17	Q9WV80	1.92e-14	71.6	522	0.259	0.080	SNX1_MOUSE Sorting nexin-1 OS=Mus musculus OX=10090 GN=Snx1 PE=1 SV=1
18	F1Q506	2.05e-14	70.1	229	0.228	0.162	SNXAA_DANRE Sorting nexin-10A OS=Danio rerio OX=7955 GN=snx10a PE=1 SV=1
19	Q99N27	2.09e-14	71.6	522	0.259	0.080	SNX1_RAT Sorting nexin-1 OS=Rattus norvegicus OX=10116 GN=Snx1 PE=1 SV=1
20	Q9P779	7.30e-14	70.1	390	0.241	0.100	YNYB_SCHPO Sorting nexin C1711.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1711.11 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00787 PX	1.6e-18	78.5	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006767996.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006764962.1	0.953	Vacuolar protein sorting-associated protein 35
2	225400.XP_006768972.1	0.934	VPS29, retromer complex component
3	225400.XP_006760989.1	0.867	Vacuolar protein sorting-associated protein 26A
4	225400.XP_006776114.1	0.867	VPS26, retromer complex component B
5	225400.XP_006759779.1	0.865	Sorting nexin-6
6	225400.XP_006776187.1	0.865	Sorting nexin 5
7	225400.XP_006777307.1	0.861	Sorting nexin-3
8	225400.XP_006765560.1	0.794	Sorting nexin-8
9	225400.XP_006755773.1	0.733	Sorting nexin-27
10	225400.XP_006767515.1	0.733	Sorting nexin 17
11	225400.XP_006766974.1	0.729	Protein wntless homolog
12	225400.XP_006766982.1	0.729	Protein wntless homolog
13	225400.XP_006770231.1	0.707	TBC1 domain family member 5 isoform X1
14	225400.XP_006764464.1	0.693	Sorting nexin-2
15	225400.XP_006770850.1	0.688	Sorting nexin-1
16	225400.XP_006774644.1	0.673	Sorting nexin-33
17	225400.XP_006761622.1	0.609	Beta-secretase 1 isoform X1
18	225400.XP_006765806.1	0.605	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
19	225400.XP_006762834.1	0.593	ADP-ribosylation factor-binding protein GGA3
20	225400.XP_006757486.1	0.588	ADP-ribosylation factor-binding protein GGA1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0035091	1.000	phosphatidylinositol binding
GO:1901981	0.556	phosphatidylinositol phosphate binding
GO:0032266	0.526	phosphatidylinositol-3-phosphate binding
GO:0044877	0.386	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0060341	0.963	regulation of cellular localization
GO:0019222	0.937	regulation of metabolic process
GO:0009894	0.927	regulation of catabolic process
GO:0032880	0.912	regulation of protein localization
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0051049	0.901	regulation of transport
GO:0080090	0.878	regulation of primary metabolic process
GO:0051171	0.878	regulation of nitrogen compound metabolic process
GO:0070201	0.838	regulation of establishment of protein localization
GO:0060627	0.805	regulation of vesicle-mediated transport
GO:0042176	0.790	regulation of protein catabolic process
GO:0051179	0.753	localization
GO:0048519	0.715	negative regulation of biological process
GO:0032386	0.713	regulation of intracellular transport
GO:0006810	0.688	transport
GO:0048523	0.688	negative regulation of cellular process
GO:0010468	0.651	regulation of gene expression
GO:0051172	0.591	negative regulation of nitrogen compound metabolic process
GO:0051128	0.590	regulation of cellular component organization
GO:0010605	0.588	negative regulation of macromolecule metabolic process
GO:1903649	0.558	regulation of cytoplasmic transport
GO:0051248	0.555	negative regulation of protein metabolic process
GO:0051224	0.539	negative regulation of protein transport
GO:0009895	0.535	negative regulation of catabolic process
GO:0042177	0.522	negative regulation of protein catabolic process
GO:0008152	0.520	metabolic process
GO:0032387	0.520	negative regulation of intracellular transport
GO:0051641	0.512	cellular localization
GO:0048518	0.484	positive regulation of biological process
GO:0030162	0.439	regulation of proteolysis
GO:0048522	0.408	positive regulation of cellular process
GO:0016192	0.357	vesicle-mediated transport
GO:0044237	0.356	cellular metabolic process
GO:0071704	0.353	organic substance metabolic process
GO:0046907	0.339	intracellular transport
GO:1903317	0.338	regulation of protein maturation
GO:0071840	0.328	cellular component organization or biogenesis
GO:0044238	0.325	primary metabolic process
GO:0050896	0.320	response to stimulus
GO:0016043	0.316	cellular component organization
GO:0031323	0.306	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005769	0.997	early endosome
GO:0016020	0.978	membrane
GO:0005829	0.941	cytosol
GO:0032991	0.923	protein-containing complex
GO:0031090	0.693	organelle membrane
GO:0010008	0.674	endosome membrane
GO:0098796	0.490	membrane protein complex
GO:1903561	0.437	extracellular vesicle
GO:0070062	0.431	extracellular exosome
GO:0030904	0.359	retromer complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]