StarFunc result for job id Q9UMZ2

User Input

>input (1314 residues)
MALRPGAGSGGGGAAGAGAGSAGGGGFMFPVAGGIRPPQAGLMPMQQQGFPMVSVMQPNM
QGIMGMNYSSQMSQGPIAMQAGIPMGPMPAAGMPYLGQAPFLGMRPPGPQYTPDMQKQFA
EEQQKRFEQQQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFS
RDAKMHPTPASHPKKPGPSLEEKFLVSCDISTSGQEQIKLNTSEVGHKALGPGSSKKYPS
LMASNGVAVDGCVSGTTTAEAENTSDQNLSIEESGVGVFPSQDPAQPRMPPWIYNESLVP
DAYKKILETTMTPTGIDTAKLYPILMSSGLPRETLGQIWALANRTTPGKLTKEELYTVLA
MIAVTQRGVPAMSPDALNQFPAAPIPTLSGFSMTLPTPVSQPTVIPSGPAGSMPLSLGQP
VMGINLVGPVGGAAAQASSGFIPTYPANQVVKPEEDDFQDFQDASKSGSLDDSFSDFQEL
PASSKTSNSQHGNSAPSLLMPLPGTKALPSMDKYAVFKGIAADKSSENTVPPGDPGDKYS
AFRELEQTAENKPLGESFAEFRSAGTDDGFTDFKTADSVSPLEPPTKDKTFPPSFPSGTI
QQKQQTQVKNPLNLADLDMFSSVNCSSEKPLSFSAVFSTSKSVSTPQSTGSAATMTALAA
TKTSSLADDFGEFSLFGEYSGLAPVGEQDDFADFMAFSNSSISSEQKPDDKYDALKEEAS
PVPLTSNVGSTVKGGQNSTAASTKYDVFRQLSLEGSGLGVEDLKDNTPSGKSDDDFADFH
SSKFSSINSDKSLGEKAVAFRHTKEDSASVKSLDLPSIGGSSVGKEDSEDALSVQFDMKL
ADVGGDLKHVMSDSSLDLPTVSGQHPPAADIEDLKYAAFGSYSSNFAVSTLTSYDWSDRD
DATQGRKLSPFVLSAGSGSPSATSILQKKETSFGSSENITMTSLSKVTTFVSEDALPETT
FPALASFKDTIPQTSEQKEYENRDYKDFTKQDLPTAERSQEATCPSPASSGASQETPNEC
SDDFGEFQSEKPKISKFDFLVATSQSKMKSSEEMIKSELATFDLSVQGSHKRSLSLGDKE
ISRSSPSPALEQPFRDRSNTLNEKPALPVIRDKYKDLTGEVEENERYAYEWQRCLGSALN
VIKKANDTLNGISSSSVCTEVIQSAQGMEYLLGVVEVYRVTKRVELGIKATAVCSEKLQQ
LLKDIDKVWNNLIGFMSLATLTPDENSLDFSSCMLRPGIKNAQELACGVCLLNVDSRSRK
EEKPAEEHPKKAFNSETDSFKLAYGGHQYHASCANFWINCVEPKPPGLVLPDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JKC9	0.196	0.194	0.000	1329	0.811	0.801	Q9JKC9.pdb.gz	SYNRG_RAT Synergin gamma OS=Rattus norvegicus OX=10116 GN=Synrg PE=1 SV=3
2	AFDB:Q9UMZ2	1.000	1.000	0.000	1314	1.000	1.000	Q9UMZ2.pdb.gz	SYNRG_HUMAN Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2
3	AFDB:O77086	0.057	0.051	2.606E-3	1571	0.138	0.115	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
4	AFDB:F4IZK5	0.051	0.049	3.885E-3	1403	0.139	0.130	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
5	AFDB:Q9H7N4	0.054	0.054	7.436E-3	1312	0.137	0.137	Q9H7N4.pdb.gz	SFR19_HUMAN Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3
6	AFDB:Q96JK9	0.044	0.047	2.345E-2	1138	0.129	0.149	Q96JK9.pdb.gz	MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens OX=9606 GN=MAML3 PE=1 SV=4
7	AFDB:P23201	0.051	0.048	2.465E-2	1466	0.131	0.117	P23201.pdb.gz	SPA2_YEAST Protein SPA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPA2 PE=1 SV=1
8	AFDB:P47806	0.045	0.050	2.465E-2	1111	0.120	0.142	P47806.pdb.gz	GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus OX=10090 GN=Gli1 PE=1 SV=4
9	AFDB:F4IXI9	0.053	0.058	3.326E-2	1192	0.128	0.141	F4IXI9.pdb.gz	F4IXI9_ARATH Dentin sialophosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=MXL8.16 PE=1 SV=1
10	AFDB:Q01389	0.035	0.034	4.062E-2	1478	0.112	0.099	Q01389.pdb.gz	BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCK1 PE=1 SV=1
11	PDB:3bnfA	0.053	0.121	1.126	471	0.011	0.032	3bnfA.pdb.gz	Binding and Reduction of Sulfite by Cytochrome c Nitrite Reductase
12	PDB:3c98B	0.044	0.222	1.126	230	0.011	0.061	3c98B.pdb.gz
13	PDB:6ikoA	0.030	0.105	1.519	303	0.015	0.066	6ikoA.pdb.gz
14	PDB:6o4oA	0.051	0.263	1.597	169	0.014	0.112	6o4oA.pdb.gz
15	PDB:2b76C	0.040	0.279	1.950	130	0.013	0.131	2b76C.pdb.gz	Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
16	PDB:1gncA	0.046	0.253	2.050	175	0.017	0.126	1gncA.pdb.gz
17	PDB:7q83D	0.050	0.229	2.155	156	0.006	0.051	7q83D.pdb.gz
18	PDB:1yo7A	0.037	0.251	2.631	120	0.010	0.108	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
19	PDB:3duhC	0.042	0.231	2.631	137	0.013	0.124	3duhC.pdb.gz
20	PDB:6mdmH	0.049	0.339	2.631	147	0.017	0.150	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JKC9	0.0	1576	1329	0.639	0.632	SYNRG_RAT Synergin gamma OS=Rattus norvegicus OX=10116 GN=Synrg PE=1 SV=3
2	Q9UMZ2	0.0	2681	1314	1.000	1.000	SYNRG_HUMAN Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2
3	Q9LM78	1.67e-04	48.5	1019	0.023	0.029	Q9LM78_ARATH Calcium-binding EF hand family protein OS=Arabidopsis thaliana OX=3702 GN=ATEH1 PE=1 SV=1
4	P34216	5.01e-04	47.0	1381	0.021	0.020	EDE1_YEAST EH domain-containing and endocytosis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EDE1 PE=1 SV=2
5	B1AUU8	0.001	45.8	762	0.021	0.037	B1AUU8_HUMAN Epidermal growth factor receptor pathway substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=1
6	P42566	0.001	45.8	896	0.021	0.031	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2
7	A0A8I5YC99	0.003	44.3	897	0.016	0.023	A0A8I5YC99_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
8	A0A8I6ALY1	0.003	44.3	847	0.016	0.025	A0A8I6ALY1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
9	A0A8I6GAG1	0.003	44.3	764	0.016	0.027	A0A8I6GAG1_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
10	A7BFV9	0.003	44.3	897	0.016	0.023	A7BFV9_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=1
11	E9PSY8	0.003	44.7	873	0.016	0.024	E9PSY8_RAT Epidermal growth factor receptor pathway substrate 15 OS=Rattus norvegicus OX=10116 GN=Eps15 PE=1 SV=3
12	P42567	0.003	44.3	897	0.014	0.021	EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus OX=10090 GN=Eps15 PE=1 SV=1
13	Q8MMD3	0.003	44.3	1106	0.017	0.020	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
14	Q5JC29	0.004	44.3	792	0.016	0.027	Q5JC29_RAT Epidermal growth factor receptor pathway substrate 15 isoform B OS=Rattus norvegicus OX=10116 GN=Eps15 PE=2 SV=1
15	Q9UBC2	0.004	43.9	864	0.017	0.025	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
16	Q8MMD2	0.005	43.9	1232	0.014	0.015	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
17	Q8WQ61	0.005	43.9	1253	0.014	0.014	Q8WQ61_DROME Eps-15 protein OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=2 SV=1
18	Q9W111	0.005	43.9	1253	0.014	0.014	Q9W111_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform A OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=2
19	Q15811	0.006	43.5	1721	0.021	0.016	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
20	E3CTP7	0.007	43.1	792	0.017	0.028	E3CTP7_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform D OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12763 EF-hand_4	34	15.8	Cytoskeletal-regulatory complex EF hand

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000238855	0.969	Aftiphilin
2	9606.ENSP00000312442	0.963	AP-1 complex subunit gamma-like 2
3	9606.ENSP00000377148	0.948	AP-1 complex subunit gamma-1
4	9606.ENSP00000444957	0.936	AP-1 complex subunit sigma-2
5	9606.ENSP00000327694	0.885	AP-2 complex subunit alpha-2
6	9606.ENSP00000351926	0.885	AP-2 complex subunit alpha-1
7	9606.ENSP00000292807	0.876	AP-2 complex subunit mu
8	9606.ENSP00000263270	0.871	AP-2 complex subunit sigma
9	9606.ENSP00000370719	0.863	Intersectin-1
10	9606.ENSP00000482835	0.853	AP-2 complex subunit beta
11	9606.ENSP00000479606	0.843	Clathrin heavy chain 1
12	9606.ENSP00000347244	0.837	Intersectin-2
13	9606.ENSP00000358582	0.836	AP-4 complex subunit beta-1
14	9606.ENSP00000309415	0.829	Clathrin light chain B
15	9606.ENSP00000242285	0.828	Clathrin light chain A
16	9606.ENSP00000336666	0.817	AP-1 complex subunit sigma-1A
17	9606.ENSP00000261842	0.815	AP-4 complex subunit epsilon-1
18	9606.ENSP00000360076	0.811	SH3-containing GRB2-like protein 3-interacting protein 1
19	9606.ENSP00000406209	0.811	Epsin-1
20	9606.ENSP00000341344	0.810	ADP-ribosylation factor-binding protein GGA1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.981	localization
GO:0006810	0.974	transport
GO:0015031	0.959	protein transport
GO:0046907	0.955	intracellular transport
GO:0006886	0.929	intracellular protein transport
GO:0065007	0.459	biological regulation
GO:0050789	0.424	regulation of biological process
GO:0050794	0.363	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030130	0.998	clathrin coat of trans-Golgi network vesicle
GO:0005829	0.952	cytosol
GO:0030119	0.909	AP-type membrane coat adaptor complex
GO:0030131	0.871	clathrin adaptor complex
GO:0005634	0.779	nucleus
GO:0070013	0.734	intracellular organelle lumen
GO:0030121	0.734	AP-1 adaptor complex
GO:0031981	0.561	nuclear lumen
GO:0005654	0.353	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]