StarFunc result for job id Q9UMZ3

User Input

>input (2332 residues)
MKKVPIKPEQPEKLRAFNISTHSFSLHWSLPSGHVERYQVDLVPDSGFVTIRDLGGGEYQ
VDVSNVVPGTRYDITISSISTTYTSPVTRIVTTNVTKPGPPVFLAGERVGSAGILLSWNT
PPNPNGRIISYIVKYKEVCPWMQTVYTQVRSKPDSLEVLLTNLNPGTTYEIKVAAENSAG
IGVFSDPFLFQTAESAPGKVVNLTVEAYNASAVKLIWYLPRQPNGKITSFKISVKHARSG
IVVKDVSIRVEDILTGKLPECNENSESFLWSTASPSPTLGRVTPPSRTTHSSSTLTQNEI
SSVWKEPISFVVTHLRPYTTYLFEVSAVTTEAGYIDSTIVRTPESVPEGPPQNCVTGNIT
GKSFSILWDPPTIVTGKFSYRVELYGPSGRILDNSTKDLKFAFTNLTPFTMYDVYIAAET
SAGTGPKSNISVFTPPDVPGAVFDLQLAEVESTQVRITWKKPRQPNGIINQYRVKVLVPE
TGIILENTLLTGNNEYINDPMAPEIVNIVEPMVGLYEGSAEMSSDLHSLATFIYNSHPDK
NFPARNRAEDQTSPVVTTRNQYITDIAAEQLSYVIRRLVPFTEHMISVSAFTIMGEGPPT
VLSVRTRQQVPSSIKIINYKNISSSSILLYWDPPEYPNGKITHYTIYAMELDTNRAFQIT
TIDNSFLITGLKKYTKYKMRVAASTHVGESSLSEENDIFVRTSEDEPESSPQDVEVIDVT
ADEIRLKWSPPEKPNGIIIAYEVLYKNIDTLYMKNTSTTDIILRNLRPHTLYNISVRSYT
RFGHGNQVSSLLSVRTSETVPDSAPENITYKNISSGEIELSFLPPSSPNGIIKKYTIYLK
RSNGNEERTINTTSLTQNIKVLKKYTQYIIEVSASTLKGEGVRSAPISILTEEDAPDSPP
QDFSVKQLSGVTVKLSWQPPLEPNGIILYYTVYVWNRSSLKTINVTETSLELSDLDYNVE
YSAYVTASTRFGDGKTRSNIISFQTPEGAPSDPPKDVYYANLSSSSIILFWTPPSKPNGI
IQYYSVYYRNTSGTFMQNFTLHEVTNDFDNMTVSTIIDKLTIFSYYTFWLTASTSVGNGN
KSSDIIEVYTDQDIPEGFVGNLTYESISSTAINVSWVPPAQPNGLVFYYVSLILQQTPRH
VRPPLVTYERSIYFDNLEKYTDYILKITPSTEKGFSDTYTAQLYIKTEEDVPETSPIINT
FKNLSSTSVLLSWDPPVKPNGAIISYDLTLQGPNENYSFITSDNYIILEELSPFTLYSFF
AAARTRKGLGPSSILFFYTDESVPLAPPQNLTLINCTSDFVWLKWSPSPLPGGIVKVYSF
KIHEHETDTIYYKNISGFKTEAKLVGLEPVSTYSIRVSAFTKVGNGNQFSNVVKFTTQES
VPDVVQNMQCMATSWQSVLVKWDPPKKANGIITQYMVTVERNSTKVSPQDHMYTFIKLLA
NTSYVFKVRASTSAGEGDESTCHVSTLPETVPSVPTNIAFSDVQSTSATLTWIRPDTILG
YFQNYKITTQLRAQKCKEWESEECVEYQKIQYLYEAHLTEETVYGLKKFRWYRFQVAAST
NAGYGNASNWISTKTLPGPPDGPPENVHVVATSPFSISISWSEPAVITGPTCYLIDVKSV
DNDEFNISFIKSNEENKTIEIKDLEIFTRYSVVITAFTGNISAAYVEGKSSAEMIVTTLE
SAPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIQVYQALVYREDDPTAVQIHNLSII
QKTNTFVIAMLEGLKGGHTYNISVYAVNSAGAGPKVPMRITMDIKAPARPKTKPTPIYDA
TGKLLVTSTTITIRMPICYYSDDHGPIKNVQVLVTETGAQHDGNVTKWYDAYFNKARPYF
TNEGFPNPPCTEGKTKFSGNEEIYIIGADNACMIPGNEDKICNGPLKPKKQYLFKFRATN
IMGQFTDSDYSDPVKTLGEGLSERTVEIILSVTLCILSIILLGTAIFAFARIRQKQKEGG
TYSPQDAEIIDTKLKLDQLITVADLELKDERLTRPISKKSFLQHVEELCTNNNLKFQEEF
SELPKFLQDLSSTDADLPWNRAKNRFPNIKPYNNNRVKLIADASVPGSDYINASYISGYL
CPNEFIATQGPLPGTVGDFWRMVWETRAKTLVMLTQCFEKGRIRCHQYWPEDNKPVTVFG
DIVITKLMEDVQIDWTIRDLKIERHGDCMTVRQCNFTAWPEHGVPENSAPLIHFVKLVRA
SRAHDTTPMIVHCSAGVGRTGVFIALDHLTQHINDHDFVDIYGLVAELRSERMCMVQNLA
QYIFLHQCILDLLSNKGSNQPICFVNYSALQKMDSLDAMEGDVELEWEETTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C5E4	0.271	0.274	0.000	2300	0.848	0.860	P0C5E4.pdb.gz	PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus OX=10090 GN=Ptprq PE=1 SV=1
2	AFDB:Q9UMZ3	1.000	1.000	0.000	2332	1.000	1.000	Q9UMZ3.pdb.gz	PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2
3	AFDB:P23467	0.127	0.147	1.691E-98	1997	0.202	0.235	P23467.pdb.gz	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3
4	AFDB:A0A0R4ITJ9	0.122	0.150	4.600E-96	1892	0.190	0.235	A0A0R4ITJ9.pdb.gz	A0A0R4ITJ9_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=R-PTP-beta PE=3 SV=2
5	AFDB:A0A0G2K2W0	0.129	0.133	9.636E-95	2238	0.196	0.204	A0A0G2K2W0.pdb.gz	A0A0G2K2W0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=2
6	AFDB:B6HY54	0.126	0.173	1.562E-87	1650	0.171	0.241	B6HY54.pdb.gz	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
7	AFDB:Q9W4F5	0.121	0.159	2.872E-86	1767	0.167	0.221	Q9W4F5.pdb.gz	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
8	AFDB:P16621	0.122	0.140	3.000E-86	2029	0.181	0.207	P16621.pdb.gz	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
9	AFDB:A0A0H2UKT5	0.122	0.148	1.157E-81	1914	0.176	0.215	A0A0H2UKT5.pdb.gz
10	AFDB:P23468	0.128	0.155	8.542E-81	1912	0.166	0.202	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
11	PDB:4gwfA	0.119	0.540	3.057E-20	497	0.047	0.219	4gwfA.pdb.gz
12	PDB:3ps5A	0.118	0.501	7.615E-20	529	0.044	0.195	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:5xzrA	0.117	0.508	7.959E-19	519	0.046	0.208	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:6krwA	0.111	0.770	7.307E-17	306	0.041	0.314	6krwA.pdb.gz
15	PDB:5a42A	0.076	0.103	9.912E-16	1597	0.054	0.079	5a42A.pdb.gz
16	PDB:7q1yA	0.053	0.077	1.533E-13	1374	0.039	0.067	7q1yA.pdb.gz
17	PDB:5oj2B	0.059	0.161	1.672E-13	692	0.037	0.126	5oj2B.pdb.gz
18	PDB:3m4uA	0.109	0.832	2.170E-13	285	0.036	0.295	3m4uA.pdb.gz
19	PDB:6pxvA	0.071	0.155	6.432E-13	823	0.033	0.092	6pxvA.pdb.gz
20	PDB:7q5zA	0.061	0.090	1.083E-12	1344	0.039	0.068	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C5E4	0.0	4142	2300	0.849	0.861	PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus OX=10090 GN=Ptprq PE=1 SV=1
2	Q9UMZ3	0.0	4796	2332	1.000	1.000	PTPRQ_HUMAN Phosphatidylinositol phosphatase PTPRQ OS=Homo sapiens OX=9606 GN=PTPRQ PE=1 SV=2
3	A4IFW2	4.06e-103	372	1909	0.172	0.210	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
4	P16621	7.73e-100	362	2029	0.169	0.195	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
5	Q8IRS0	4.35e-97	350	1607	0.099	0.144	Q8IRS0_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
6	E1JJE4	6.01e-97	350	1615	0.099	0.144	E1JJE4_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
7	P35992	7.02e-97	352	1990	0.136	0.159	PTP10_DROME Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4
8	X2JCK2	1.38e-96	350	1761	0.099	0.132	X2JCK2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=4 SV=1
9	Q9W4F5	1.44e-96	350	1767	0.099	0.131	Q9W4F5_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
10	Q24495	1.69e-95	347	1767	0.099	0.131	Q24495_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
11	Q8SXB2	1.09e-92	329	1064	0.096	0.211	Q8SXB2_DROME protein-tyrosine-phosphatase OS=Drosophila melanogaster OX=7227 GN=Ptp4E PE=2 SV=1
12	Q16827	8.13e-83	301	1216	0.061	0.118	PTPRO_HUMAN Receptor-type tyrosine-protein phosphatase O OS=Homo sapiens OX=9606 GN=PTPRO PE=1 SV=2
13	Q28613	9.98e-83	301	1187	0.061	0.120	Q28613_RABIT protein-tyrosine-phosphatase OS=Oryctolagus cuniculus OX=9986 GN=PTPRO PE=2 SV=1
14	Q98945	2.05e-82	301	1267	0.061	0.113	Q98945_CHICK protein-tyrosine-phosphatase OS=Gallus gallus OX=9031 PE=1 SV=1
15	A0A8I5YC57	5.00e-82	299	1188	0.061	0.120	A0A8I5YC57_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
16	B2RU80	7.38e-82	303	1998	0.146	0.171	PTPRB_MOUSE Receptor-type tyrosine-protein phosphatase beta OS=Mus musculus OX=10090 GN=Ptprb PE=1 SV=1
17	Q62797	8.36e-82	298	1216	0.061	0.118	Q62797_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
18	F7F9Z5	1.06e-81	298	1215	0.061	0.118	F7F9Z5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpro PE=4 SV=1
19	D3ZTG5	4.78e-81	301	2004	0.121	0.141	D3ZTG5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=1 SV=3
20	A0A8I5ZV35	5.45e-81	300	2000	0.121	0.141	A0A8I5ZV35_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprb PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	2.3e+02	13.0	Dual specificity phosphatase, catalytic domain
2	PF00041 fn3	4.4e-162	538.2	Fibronectin type III domain
3	PF16893 fn3_2	0.00046	31.6	Fibronectin type III domain
4	PF09294 Interfer-bind	0.00067	31.3	Interferon-alpha/beta receptor, fibronectin type III
5	PF14566 PTPlike_phytase	2.3e+02	13.3	Inositol hexakisphosphate
6	PF18861 PTP_tm	0.14	23.9	TM proximal of protein tyrosine phosphatase, receptor type J
7	PF16656 Pur_ac_phosph_N	2.3e-20	84.3	Purple acid Phosphatase, N-terminal domain
8	PF00102 Y_phosphatase	8.1e-72	253.1	Protein-tyrosine phosphatase
9	PF13350 Y_phosphatase3	4.4	18.8	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387100	0.796	Taperin
2	9606.ENSP00000257627	0.779	Putative oncomodulin-2
3	9606.ENSP00000242104	0.778	Oncomodulin-1
4	9606.ENSP00000358994	0.764	Unconventional myosin-VI
5	9606.ENSP00000304783	0.760	Prestin
6	9606.ENSP00000348772	0.760	Membrane-associated phosphatidylinositol transfer protein 1
7	9606.ENSP00000401513	0.728	Stereocilin
8	9606.ENSP00000384312	0.701	TRIO and F-actin-binding protein
9	9606.ENSP00000297784	0.688	Transmembrane channel-like protein 1
10	9606.ENSP00000381768	0.687	Cadherin-23
11	9606.ENSP00000265944	0.686	Myosin-IIIa
12	9606.ENSP00000363068	0.663	Protocadherin-15
13	9606.ENSP00000205890	0.657	Unconventional myosin-XV
14	9606.ENSP00000367059	0.637	Espin
15	9606.ENSP00000185206	0.631	Chloride intracellular channel protein 5
16	9606.ENSP00000386331	0.630	Unconventional myosin-VIIa
17	9606.ENSP00000418112	0.629	Receptor-type tyrosine-protein phosphatase gamma
18	9606.ENSP00000384582	0.628	G-protein coupled receptor 98
19	9606.ENSP00000272371	0.620	Otoferlin
20	9606.ENSP00000354623	0.597	Whirlin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0005001	0.939	transmembrane receptor protein tyrosine phosphatase activity
GO:0019899	0.508	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.977	biological regulation
GO:0050794	0.968	regulation of cellular process
GO:0009987	0.948	cellular process
GO:0032501	0.746	multicellular organismal process
GO:0050793	0.732	regulation of developmental process
GO:0050896	0.620	response to stimulus
GO:0045595	0.553	regulation of cell differentiation
GO:0032502	0.525	developmental process
GO:0048856	0.517	anatomical structure development
GO:0008152	0.438	metabolic process
GO:0007275	0.437	multicellular organism development
GO:0045598	0.433	regulation of fat cell differentiation
GO:0048731	0.420	system development
GO:0071704	0.395	organic substance metabolic process
GO:0044238	0.380	primary metabolic process
GO:0050954	0.314	sensory perception of mechanical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0098862	0.790	cluster of actin-based cell projections
GO:0043226	0.779	organelle
GO:0005622	0.745	intracellular anatomical structure
GO:0071944	0.718	cell periphery
GO:0005737	0.705	cytoplasm
GO:0043227	0.704	membrane-bounded organelle
GO:0016020	0.643	membrane
GO:0032421	0.574	stereocilium bundle
GO:0043229	0.523	intracellular organelle
GO:0030054	0.316	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]