StarFunc result for job id Q9UN30

User Input

>input (329 residues)
MMSNSSSEIDVIKTRIPTYDEDDNTILYAYETKPEFVNKEPNIVSDASCNTEEQLKTVDD
VLIHCQVIYDALQNLDKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQ
KMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPS
PVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPV
ENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVL
LKHLGVKLGTAVKLCYYIDRLKQGKCFEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UN30	1.000	1.000	1.294E-51	329	1.000	1.000	Q9UN30.pdb.gz	SCML1_HUMAN Sex comb on midleg-like protein 1 OS=Homo sapiens OX=9606 GN=SCML1 PE=1 SV=2
2	AFDB:E7EZ04	0.250	0.216	1.235E-10	383	0.210	0.180	E7EZ04.pdb.gz
3	AFDB:Q9UQR0	0.223	0.106	8.738E-10	700	0.201	0.094	Q9UQR0.pdb.gz	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1
4	AFDB:F1Q6P6	0.208	0.146	4.509E-9	473	0.219	0.152	F1Q6P6.pdb.gz
5	AFDB:Q9VHA0	0.230	0.093	9.937E-8	877	0.152	0.057	Q9VHA0.pdb.gz	SCM_DROME Polycomb protein Scm OS=Drosophila melanogaster OX=7227 GN=Scm PE=1 SV=2
6	AFDB:Q8K214	0.211	0.099	1.058E-7	706	0.173	0.081	Q8K214.pdb.gz	SCMH1_MOUSE Polycomb protein SCMH1 OS=Mus musculus OX=10090 GN=Scmh1 PE=1 SV=1
7	AFDB:Q9JMD1	0.214	0.084	7.489E-7	863	0.158	0.060	Q9JMD1.pdb.gz	SMBT1_MOUSE Scm-like with four MBT domains protein 1 OS=Mus musculus OX=10090 GN=Sfmbt1 PE=1 SV=1
8	AFDB:A0A024R338	0.206	0.080	1.241E-6	866	0.167	0.064	A0A024R338.pdb.gz
9	AFDB:Q1RNF8	0.228	0.142	2.332E-6	542	0.179	0.109	Q1RNF8.pdb.gz	SAM11_MOUSE Sterile alpha motif domain-containing protein 11 OS=Mus musculus OX=10090 GN=Samd11 PE=2 SV=1
10	AFDB:Q8C8Y5	0.216	0.161	7.738E-6	445	0.134	0.099	Q8C8Y5.pdb.gz	SAMD7_MOUSE Sterile alpha motif domain-containing protein 7 OS=Mus musculus OX=10090 GN=Samd7 PE=2 SV=4
11	PDB:3bs5A	0.177	0.572	1.211E-2	86	0.058	0.221	3bs5A.pdb.gz
12	PDB:7anwA	0.181	0.094	2.277E-2	645	0.061	0.031	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
13	PDB:6brhB	0.178	0.118	4.560E-2	502	0.067	0.044	6brhB.pdb.gz	The SAM domain of mouse SAMHD1 is critical for its activation and regulation.
14	PDB:7cm7A	0.190	0.102	1.036E-1	620	0.061	0.032	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
15	PDB:6wpkA	0.191	0.116	1.175E-1	547	0.067	0.040	6wpkA.pdb.gz
16	PDB:2qb0B	0.186	0.247	4.153E-1	241	0.055	0.075	2qb0B.pdb.gz	Polymer-driven crystallization.
17	PDB:7fbcA	0.096	0.072	6.881E-1	461	0.040	0.028	7fbcA.pdb.gz
18	PDB:7l08a	0.081	0.192	2.431	108	0.030	0.093	7l08a.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
19	PDB:5wviU	0.102	0.112	2.758	282	0.055	0.064	5wviU.pdb.gz	High-resolution cryo-EM structure of the proteasome in complex with ADP-AlFx
20	PDB:3g33B	0.121	0.163	2.938	229	0.033	0.048	3g33B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UN30	0.0	683	329	1.000	1.000	SCML1_HUMAN Sex comb on midleg-like protein 1 OS=Homo sapiens OX=9606 GN=SCML1 PE=1 SV=2
2	Q9UQR0	1.97e-26	112	700	0.173	0.081	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1
3	Q8N228	1.16e-24	105	414	0.143	0.114	SCML4_HUMAN Sex comb on midleg-like protein 4 OS=Homo sapiens OX=9606 GN=SCML4 PE=1 SV=2
4	Q96GD3	4.94e-22	99.0	660	0.155	0.077	SCMH1_HUMAN Polycomb protein SCMH1 OS=Homo sapiens OX=9606 GN=SCMH1 PE=1 SV=1
5	A0A571BGE2	8.72e-22	91.3	130	0.146	0.369	A0A571BGE2_MOUSE Scm polycomb group protein like 2 (Fragment) OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
6	Q8K214	1.68e-18	88.6	706	0.125	0.058	SCMH1_MOUSE Polycomb protein SCMH1 OS=Mus musculus OX=10090 GN=Scmh1 PE=1 SV=1
7	Q9VHA0	1.83e-12	70.5	877	0.091	0.034	SCM_DROME Polycomb protein Scm OS=Drosophila melanogaster OX=7227 GN=Scm PE=1 SV=2
8	Q9JMD1	6.30e-11	65.9	863	0.116	0.044	SMBT1_MOUSE Scm-like with four MBT domains protein 1 OS=Mus musculus OX=10090 GN=Sfmbt1 PE=1 SV=1
9	Q9UHJ3	7.69e-11	65.5	866	0.119	0.045	SMBT1_HUMAN Scm-like with four MBT domains protein 1 OS=Homo sapiens OX=9606 GN=SFMBT1 PE=1 SV=2
10	Q5VUG0	9.57e-10	62.0	894	0.094	0.035	SMBT2_HUMAN Scm-like with four MBT domains protein 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
11	A0A669KBL2	9.83e-10	62.0	893	0.094	0.035	A0A669KBL2_HUMAN Scm like with four mbt domains 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
12	J3KQH6	1.81e-09	61.2	959	0.097	0.033	J3KQH6_HUMAN Polyhomeotic homolog 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=1
13	Q8NDX5	3.24e-09	60.5	983	0.094	0.032	PHC3_HUMAN Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3 PE=1 SV=1
14	Q8CHP6	1.05e-08	58.9	981	0.094	0.032	PHC3_MOUSE Polyhomeotic-like protein 3 OS=Mus musculus OX=10090 GN=Phc3 PE=1 SV=2
15	Q64028	1.91e-07	55.1	1010	0.097	0.032	PHC1_MOUSE Polyhomeotic-like protein 1 OS=Mus musculus OX=10090 GN=Phc1 PE=1 SV=3
16	P78364	2.27e-07	54.7	1004	0.097	0.032	PHC1_HUMAN Polyhomeotic-like protein 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=3
17	Q59GP6	2.30e-07	54.7	1099	0.097	0.029	Q59GP6_HUMAN Polyhomeotic-like protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
18	A0A0A0MSI2	5.51e-07	53.5	830	0.088	0.035	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
19	B7ZLY0	5.71e-07	53.5	830	0.088	0.035	B7ZLY0_HUMAN PHC2 protein OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
20	Q8IXK0	5.82e-07	53.5	858	0.088	0.034	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	1.7e-15	68.5	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	0.0029	29.0	SAM domain (Sterile alpha motif)
3	PF02198 SAM_PNT	9.7	17.6	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440674	0.749	Polyhomeotic-like protein 1
2	9606.ENSP00000482063	0.583	Polycomb group RING finger protein 2
3	9606.ENSP00000257118	0.512	Polyhomeotic-like protein 2
4	9606.ENSP00000420294	0.512	Polyhomeotic-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.337	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.897	regulation of biological process
GO:0050794	0.890	regulation of cellular process
GO:0019222	0.882	regulation of metabolic process
GO:0060255	0.870	regulation of macromolecule metabolic process
GO:0010468	0.862	regulation of gene expression
GO:0031323	0.852	regulation of cellular metabolic process
GO:0080090	0.835	regulation of primary metabolic process
GO:0051171	0.835	regulation of nitrogen compound metabolic process
GO:0009889	0.797	regulation of biosynthetic process
GO:0010556	0.786	regulation of macromolecule biosynthetic process
GO:0031326	0.781	regulation of cellular biosynthetic process
GO:0019219	0.781	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.767	regulation of RNA metabolic process
GO:0006355	0.748	regulation of DNA-templated transcription
GO:0071704	0.700	organic substance metabolic process
GO:0044238	0.697	primary metabolic process
GO:0006807	0.656	nitrogen compound metabolic process
GO:0009987	0.641	cellular process
GO:0043170	0.606	macromolecule metabolic process
GO:0019538	0.577	protein metabolic process
GO:0043412	0.567	macromolecule modification
GO:0036211	0.558	protein modification process
GO:0016570	0.494	histone modification
GO:0070647	0.456	protein modification by small protein conjugation or removal
GO:0016567	0.444	protein ubiquitination
GO:0016574	0.377	histone ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0032991	0.941	protein-containing complex
GO:0005654	0.460	nucleoplasm
GO:0043232	0.371	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]