StarFunc result for job id Q9UN37

User Input

>input (437 residues)
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q793F9	0.980	0.980	2.942E-78	437	0.991	0.991	Q793F9.pdb.gz	VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus OX=10116 GN=Vps4a PE=1 SV=1
2	AFDB:O75351	0.789	0.778	3.494E-67	444	0.815	0.802	O75351.pdb.gz	VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2
3	AFDB:A0A0R4IPK7	0.878	0.762	1.119E-66	507	0.792	0.682	A0A0R4IPK7.pdb.gz	A0A0R4IPK7_DANRE vesicle-fusing ATPase OS=Danio rerio OX=7955 GN=ch73-81e6.1 PE=1 SV=1
4	AFDB:D0FH76	0.837	0.835	2.475E-66	438	0.792	0.790	D0FH76.pdb.gz	VPS4_BOMMO Vacuolar protein sorting-associated protein 4 OS=Bombyx mori OX=7091 GN=VPS4 PE=1 SV=1
5	AFDB:Q9Y162	0.789	0.780	6.238E-65	442	0.746	0.738	Q9Y162.pdb.gz	Q9Y162_DROME vesicle-fusing ATPase OS=Drosophila melanogaster OX=7227 GN=Vps4 PE=1 SV=1
6	AFDB:Q9BL83	0.759	0.771	1.204E-61	430	0.675	0.686	Q9BL83.pdb.gz	Q9BL83_CAEEL vesicle-fusing ATPase OS=Caenorhabditis elegans OX=6239 GN=vps-4 PE=1 SV=4
7	AFDB:Q09803	0.750	0.758	6.499E-55	432	0.572	0.579	Q09803.pdb.gz	VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps4 PE=3 SV=1
8	AFDB:Q54PT2	0.761	0.750	2.712E-54	444	0.604	0.595	Q54PT2.pdb.gz	VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum OX=44689 GN=vps4 PE=3 SV=1
9	AFDB:P52917	0.771	0.771	3.014E-54	437	0.602	0.602	P52917.pdb.gz	VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS4 PE=1 SV=1
10	AFDB:Q57V58	0.755	0.744	3.436E-53	444	0.547	0.538	Q57V58.pdb.gz	Q57V58_TRYB2 Katanin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.340 PE=3 SV=1
11	PDB:2zanA	0.672	0.928	4.869E-42	312	0.606	0.849	2zanA.pdb.gz	Nucleotide-dependent conformational changes and assembly of the AAA ATPase SKD1/VPS4B
12	PDB:6ap1B	0.668	0.890	1.729E-39	322	0.506	0.686	6ap1B.pdb.gz	The AAA ATPase Vps4 binds ESCRT-III substrates through a repeating array of dipeptide-binding pockets.
13	PDB:6ugdE	0.586	0.801	1.302E-23	312	0.300	0.420	6ugdE.pdb.gz	Katanin Grips the beta-Tubulin Tail through an Electropositive Double Spiral to Sever Microtubules.
14	PDB:5wc1A	0.525	0.853	1.561E-20	262	0.261	0.435	5wc1A.pdb.gz
15	PDB:7vcsA	0.571	0.334	1.020E-18	766	0.243	0.138	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
16	PDB:6opcB	0.558	0.338	3.099E-18	741	0.243	0.143	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
17	PDB:6fvtM	0.490	0.508	2.439E-17	421	0.199	0.207	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
18	PDB:7z11D	0.565	0.345	3.724E-17	734	0.192	0.114	7z11D.pdb.gz	Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
19	PDB:7ln6F	0.527	0.329	4.365E-17	714	0.208	0.127	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
20	PDB:5l4gL	0.505	0.563	5.687E-17	389	0.201	0.226	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IPK7	0.0	708	507	0.792	0.682	A0A0R4IPK7_DANRE vesicle-fusing ATPase OS=Danio rerio OX=7955 GN=ch73-81e6.1 PE=1 SV=1
2	A5WWM0	0.0	711	437	0.796	0.796	A5WWM0_DANRE vesicle-fusing ATPase OS=Danio rerio OX=7955 GN=ch73-81e6.1 PE=1 SV=1
3	D0FH76	0.0	691	438	0.780	0.779	VPS4_BOMMO Vacuolar protein sorting-associated protein 4 OS=Bombyx mori OX=7091 GN=VPS4 PE=1 SV=1
4	O75351	0.0	750	444	0.815	0.802	VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2
5	P46467	0.0	715	444	0.810	0.797	VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus OX=10090 GN=Vps4b PE=1 SV=2
6	P52917	0.0	521	437	0.604	0.604	VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS4 PE=1 SV=1
7	Q54PT2	0.0	523	444	0.604	0.595	VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum OX=44689 GN=vps4 PE=3 SV=1
8	Q793F9	0.0	903	437	0.991	0.991	VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus OX=10116 GN=Vps4a PE=1 SV=1
9	Q8VEJ9	0.0	903	437	0.991	0.991	VPS4A_MOUSE Vacuolar protein sorting-associated protein 4A OS=Mus musculus OX=10090 GN=Vps4a PE=1 SV=1
10	Q9BL83	0.0	599	430	0.668	0.679	Q9BL83_CAEEL vesicle-fusing ATPase OS=Caenorhabditis elegans OX=6239 GN=vps-4 PE=1 SV=4
11	Q9UN37	0.0	909	437	1.000	1.000	VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1
12	Q9Y162	0.0	648	442	0.732	0.724	Q9Y162_DROME vesicle-fusing ATPase OS=Drosophila melanogaster OX=7227 GN=Vps4 PE=1 SV=1
13	Q5AG40	3.08e-178	506	439	0.570	0.567	VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VPS4 PE=2 SV=1
14	Q09803	7.17e-173	493	432	0.572	0.579	VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps4 PE=3 SV=1
15	Q57V58	9.66e-172	490	444	0.551	0.543	Q57V58_TRYB2 Katanin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.340 PE=3 SV=1
16	E9AEB2	3.49e-160	461	445	0.540	0.530	E9AEB2_LEIMA vesicle-fusing ATPase OS=Leishmania major OX=5664 GN=VPS4 PE=3 SV=1
17	Q9ZNT0	6.80e-157	452	435	0.545	0.547	VPS4_ARATH Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana OX=3702 GN=SKD1 PE=1 SV=1
18	Q8IKQ5	1.54e-120	359	419	0.423	0.442	Q8IKQ5_PLAF7 Vacuolar protein sorting-associated protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1457500 PE=4 SV=1
19	B9DGC0	2.61e-84	265	393	0.327	0.364	B9DGC0_ARATH AT2G34560 protein OS=Arabidopsis thaliana OX=3702 GN=CCP1 PE=1 SV=1
20	Q9SEX2	3.08e-84	269	523	0.357	0.298	KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana OX=3702 GN=AAA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.8e-37	140.2	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.5	21.8	AAA domain
3	PF13191 AAA_16	0.038	25.8	AAA ATPase domain
4	PF13207 AAA_17	9.9	18.0	AAA domain
5	PF13238 AAA_18	1.4	20.9	AAA domain
6	PF07724 AAA_2	4.4	18.9	AAA domain (Cdc48 subfamily)
7	PF13401 AAA_22	0.053	25.2	AAA domain
8	PF13479 AAA_24	56	14.9	AAA domain
9	PF13481 AAA_25	0.51	21.4	AAA domain
10	PF13671 AAA_33	5.5	18.6	AAA domain
11	PF07728 AAA_5	0.32	22.4	AAA domain (dynein-related subfamily)
12	PF12775 AAA_7	1.3e+02	13.5	P-loop containing dynein motor region
13	PF17862 AAA_lid_3	1.4e-05	36.2	AAA+ lid domain
14	PF06745 ATPase	57	14.5	KaiC
15	PF20030 bpMoxR	2.8e+02	11.9	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
16	PF19263 DUF5906	1.9e+02	14.2	Family of unknown function (DUF5906)
17	PF05673 DUF815	1.6	19.3	Protein of unknown function (DUF815)
18	PF10587 EF-1_beta_acid	95	14.8	Eukaryotic elongation factor 1 beta central acidic region
19	PF00625 Guanylate_kin	3.9e+02	12.1	Guanylate kinase
20	PF01695 IstB_IS21	0.26	22.3	IstB-like ATP binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254950

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380998	0.999	Charged multivesicular body protein 1a
2	9606.ENSP00000356602	0.998	Vacuolar protein sorting-associated protein VTA1 homolog
3	9606.ENSP00000432279	0.998	Charged multivesicular body protein 1b
4	9606.ENSP00000317468	0.997	Charged multivesicular body protein 6
5	9606.ENSP00000469240	0.997	Charged multivesicular body protein 2a
6	9606.ENSP00000324205	0.992	Charged multivesicular body protein 4a
7	9606.ENSP00000217402	0.991	Charged multivesicular body protein 4b
8	9606.ENSP00000438399	0.989	IST1 homolog
9	9606.ENSP00000331201	0.979	Hepatocyte growth factor-regulated tyrosine kinase substrate
10	9606.ENSP00000223500	0.978	Charged multivesicular body protein 5
11	9606.ENSP00000238497	0.975	Vacuolar protein sorting-associated protein 4B
12	9606.ENSP00000263780	0.972	Charged multivesicular body protein 2b
13	9606.ENSP00000297265	0.966	Charged multivesicular body protein 4c
14	9606.ENSP00000366565	0.958	Vacuolar protein sorting-associated protein 28 homolog
15	9606.ENSP00000405575	0.946	Charged multivesicular body protein 3
16	9606.ENSP00000251968	0.944	Tumor susceptibility gene 101 protein
17	9606.ENSP00000304697	0.927	Polyubiquitin-B
18	9606.ENSP00000367299	0.923	Vacuolar protein-sorting-associated protein 36
19	9606.ENSP00000267202	0.910	Vacuolar protein sorting-associated protein 37B
20	9606.ENSP00000253794	0.908	Vacuolar protein-sorting-associated protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0140657	0.921	ATP-dependent activity
GO:0003824	0.921	catalytic activity
GO:0097159	0.917	organic cyclic compound binding
GO:1901363	0.908	heterocyclic compound binding
GO:0097367	0.697	carbohydrate derivative binding
GO:0032555	0.403	purine ribonucleotide binding
GO:0035639	0.370	purine ribonucleoside triphosphate binding
GO:0140776	0.308	protein-containing complex destabilizing activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0071840	0.966	cellular component organization or biogenesis
GO:0051179	0.939	localization
GO:0016043	0.934	cellular component organization
GO:0008152	0.717	metabolic process
GO:0044237	0.688	cellular metabolic process
GO:0051234	0.682	establishment of localization
GO:0006996	0.634	organelle organization
GO:0065007	0.585	biological regulation
GO:0006810	0.584	transport
GO:0050789	0.570	regulation of biological process
GO:0071704	0.531	organic substance metabolic process
GO:0050896	0.512	response to stimulus
GO:0050794	0.498	regulation of cellular process
GO:0006807	0.496	nitrogen compound metabolic process
GO:0051641	0.495	cellular localization
GO:0019058	0.488	viral life cycle
GO:0006914	0.483	autophagy
GO:0010256	0.480	endomembrane system organization
GO:0043170	0.479	macromolecule metabolic process
GO:0022607	0.465	cellular component assembly
GO:0046907	0.452	intracellular transport
GO:0044238	0.431	primary metabolic process
GO:0016192	0.427	vesicle-mediated transport
GO:0016050	0.414	vesicle organization
GO:0019068	0.402	virion assembly
GO:0046755	0.390	viral budding
GO:0044000	0.376	movement in host
GO:0044260	0.339	cellular macromolecule metabolic process
GO:0007032	0.302	endosome organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0031410	0.998	cytoplasmic vesicle
GO:0005768	0.994	endosome
GO:0016020	0.993	membrane
GO:0005829	0.989	cytosol
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005576	0.968	extracellular region
GO:0031090	0.957	organelle membrane
GO:0070062	0.946	extracellular exosome
GO:0012506	0.935	vesicle membrane
GO:0015630	0.931	microtubule cytoskeleton
GO:0010008	0.925	endosome membrane
GO:0005634	0.918	nucleus
GO:0005819	0.825	spindle
GO:0030496	0.762	midbody
GO:0048471	0.617	perinuclear region of cytoplasm
GO:0071944	0.599	cell periphery
GO:0005886	0.570	plasma membrane
GO:0005815	0.532	microtubule organizing center
GO:0005813	0.510	centrosome
GO:0005769	0.480	early endosome
GO:0005770	0.443	late endosome
GO:0000922	0.439	spindle pole
GO:0032991	0.438	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]