StarFunc result for job id Q9UN81

User Input

>input (338 residues)
MGKKQNRKTGNSKTQSASPPPKERSSSPATEQSWMENDFDELREEGFRRSNYSELREDIQ
TKGKEVENFEKNLEECITRITNTEKCLKELMELKTKARELREECRSLRSRCDQLEERVSA
MEDEMNEMKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQD
IIQENFPNLARQANVQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRV
TLKGKPIRLTADLSAETLQARREWGPIFNILKEKNFQPRISYPAKLSFISEGEIKYFIDK
QMLRDFVTTRPALKELLKEALNMERNNRYQPLQNHAKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UN81	1.000	1.000	7.516E-57	338	1.000	1.000	Q9UN81.pdb.gz	LORF1_HUMAN LINE-1 retrotransposable element ORF1 protein OS=Homo sapiens OX=9606 GN=L1RE1 PE=1 SV=1
2	AFDB:Q5T7N2	0.512	0.213	2.298E-23	865	0.305	0.119	Q5T7N2.pdb.gz	LITD1_HUMAN LINE-1 type transposase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=L1TD1 PE=1 SV=1
3	AFDB:P11260	0.633	0.601	5.195E-23	357	0.334	0.317	P11260.pdb.gz	LORF1_MOUSE LINE-1 retrotransposable element ORF1 protein OS=Mus musculus OX=10090 GN=Lire1 PE=1 SV=2
4	AFDB:Q8NB66	0.231	0.040	5.551E-6	2214	0.166	0.025	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
5	AFDB:F4KBV3	0.207	0.259	6.532E-4	265	0.104	0.132	F4KBV3.pdb.gz	F4KBV3_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PABN1 PE=1 SV=1
6	AFDB:D3ZSC8	0.286	0.308	4.029E-3	303	0.127	0.142	D3ZSC8.pdb.gz	DJC17_RAT DnaJ homolog subfamily C member 17 OS=Rattus norvegicus OX=10116 GN=Dnajc17 PE=3 SV=1
7	PDB:5vsuA	0.196	0.173	9.384E-3	387	0.101	0.088	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
8	PDB:3lqvB	0.198	0.510	1.871E-2	115	0.038	0.113	3lqvB.pdb.gz	Branch Recognition by SF3b14
9	PDB:6n7rC	0.191	0.419	2.121E-2	133	0.059	0.150	6n7rC.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
10	AFDB:Q8L9M9	0.192	0.237	3.194E-2	267	0.086	0.109	Q8L9M9.pdb.gz	Q8L9M9_ARATH Putative RRM-containing protein OS=Arabidopsis thaliana OX=3702 GN=BPL4 PE=1 SV=1
11	PDB:3pgwP	0.182	0.445	3.731E-2	113	0.053	0.159	3pgwP.pdb.gz
12	PDB:5yzg1	0.177	0.235	4.230E-2	243	0.056	0.078	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:7eu1M	0.202	0.072	4.230E-2	1055	0.047	0.015	7eu1M.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
14	PDB:3n5fA	0.120	0.110	4.504E-2	406	0.074	0.062	3n5fA.pdb.gz	Mutational and structural analysis of L-N-carbamoylase reveals new insights into a peptidase m20/m25/m40 family member.
15	PDB:6g90B	0.195	0.318	4.795E-2	193	0.036	0.062	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
16	PDB:6ff7X	0.185	0.331	5.106E-2	171	0.062	0.123	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:7dvqY	0.187	0.398	5.106E-2	140	0.047	0.114	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
18	AFDB:Q9VGR0	0.169	0.187	6.369E-2	299	0.089	0.100	Q9VGR0.pdb.gz	Q9VGR0_DROME RE47242p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17187 PE=1 SV=2
19	AFDB:Q6Q151	0.190	0.137	1.970E-1	506	0.044	0.030	Q6Q151.pdb.gz	CYP59_ARATH Peptidyl-prolyl cis-trans isomerase CYP59 OS=Arabidopsis thaliana OX=3702 GN=CYP59 PE=1 SV=1
20	AFDB:Q9AXU3	0.104	0.091	2.696E-1	420	0.112	0.090	Q9AXU3.pdb.gz	SPA15_IPOBA Senescence-associated protein SPA15, chloroplastic OS=Ipomoea batatas OX=4120 GN=SPA15 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UN81	0.0	689	338	1.000	1.000	LORF1_HUMAN LINE-1 retrotransposable element ORF1 protein OS=Homo sapiens OX=9606 GN=L1RE1 PE=1 SV=1
2	P11260	8.78e-51	174	357	0.293	0.277	LORF1_MOUSE LINE-1 retrotransposable element ORF1 protein OS=Mus musculus OX=10090 GN=Lire1 PE=1 SV=2
3	Q5T7N2	1.37e-44	165	865	0.263	0.103	LITD1_HUMAN LINE-1 type transposase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=L1TD1 PE=1 SV=1
4	Q9LI74	0.061	37.7	1004	0.098	0.033	CHUP1_ARATH Protein CHUP1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHUP1 PE=1 SV=1
5	F4JHE9	0.31	35.4	1185	0.071	0.020	F4JHE9_ARATH K+ efflux antiporter 2 OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=1
6	O65272	0.31	35.4	1174	0.071	0.020	KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=2
7	D3ZT01	0.32	35.4	730	0.092	0.042	D3ZT01_RAT Conserved oligomeric Golgi complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Cog2 PE=3 SV=1
8	Q8C6D4	0.35	35.0	421	0.089	0.071	BEND5_MOUSE BEN domain-containing protein 5 OS=Mus musculus OX=10090 GN=Bend5 PE=2 SV=1
9	Q14746	0.40	35.0	738	0.092	0.042	COG2_HUMAN Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2 PE=1 SV=1
10	A0A2C9C2L6	0.81	33.9	624	0.124	0.067	A0A2C9C2L6_CAEEL Intraflagellar transport protein 74 homolog OS=Caenorhabditis elegans OX=6239 GN=ift-74 PE=4 SV=1
11	Q7L4P6	0.88	33.9	421	0.086	0.069	BEND5_HUMAN BEN domain-containing protein 5 OS=Homo sapiens OX=9606 GN=BEND5 PE=1 SV=1
12	G8IHU0	1.0	33.9	3078	0.053	0.006	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
13	A0A0C4DG40	2.0	33.1	8749	0.127	0.005	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
14	Q8NF91	2.0	33.1	8797	0.127	0.005	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
15	Q804T6	4.1	31.6	443	0.059	0.045	DIX1A_DANRE Dixin-A OS=Danio rerio OX=7955 GN=dixdc1a PE=1 SV=1
16	Q18406	4.7	31.6	659	0.065	0.033	EXOC5_CAEEL Exocyst complex component 5 OS=Caenorhabditis elegans OX=6239 GN=sec-10 PE=3 SV=1
17	P15215	4.8	31.6	1639	0.127	0.026	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
18	A0A1D8PP87	5.6	30.8	252	0.038	0.052	A0A1D8PP87_CANAL Cta24p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTA24 PE=4 SV=1
19	A0A1D8PC38	5.7	30.8	255	0.038	0.051	A0A1D8PC38_CANAL Cta2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTA2 PE=4 SV=1
20	E7EYJ3	5.7	31.6	903	0.127	0.048	E7EYJ3_DANRE Hyaluronan-mediated motility receptor (RHAMM) OS=Danio rerio OX=7955 GN=wu:fb43e12 PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	1e+02	13.1	AAA domain
2	PF10337 ArAE_2_N	36	14.9	Putative ER transporter, 6TM, N-terminal
3	PF10186 ATG14	1e+02	13.4	Vacuolar sorting 38 and autophagy-related subunit 14
4	PF08614 ATG16	15	17.2	Autophagy protein 16 (ATG16)
5	PF10473 CENP-F_leu_zip	3.6e+02	12.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
6	PF19220 Crescentin	3.1e+02	11.8	Crescentin protein
7	PF07889 DUF1664	19	16.7	Protein of unknown function (DUF1664)
8	PF11690 DUF3287	6.2e+02	11.5	Protein of unknown function (DUF3287)
9	PF19111 DUF5798	1.2e+02	14.3	Family of unknown function (DUF5798)
10	PF11250 FAF	1.6e+02	13.9	Fantastic Four meristem regulator
11	PF13851 GAS	2.1	19.2	Growth-arrest specific micro-tubule binding
12	PF19191 HEF_HK	1.3e+02	14.5	HEF_HK domain
13	PF10205 KLRAQ	2.3e+02	13.5	Predicted coiled-coil domain-containing protein
14	PF11214 Med2	91	14.6	Mediator complex subunit 2
15	PF15180 NPBW	5.2e+02	11.9	Neuropeptides B and W
16	PF18595 Nuf2_DHR10-like	2.4e+02	13.2	Nuf2, DHR10-like domain
17	PF05478 Prominin	11	15.5	Prominin
18	PF04136 Sec34	10	17.5	Sec34-like family
19	PF04048 Sec8_exocyst	1.5e+02	13.7	Sec8 exocyst complex component specific domain
20	PF02403 Seryl_tRNA_N	5.4	18.7	Seryl-tRNA synthetase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000024013

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013612	0.563	Tripartite motif containing 28
2	61853.ENSNLEP00000018140	0.539	KN motif and ankyrin repeat domains 4
3	61853.ENSNLEP00000015813	0.525	Craniofacial development protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0003727	0.999	single-stranded RNA binding
GO:0003697	0.999	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.709	regulation of biological process
GO:0050794	0.667	regulation of cellular process
GO:0048519	0.390	negative regulation of biological process
GO:0048523	0.349	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0032991	0.998	protein-containing complex
GO:0031981	0.998	nuclear lumen
GO:0099080	0.997	supramolecular complex
GO:0035770	0.991	ribonucleoprotein granule
GO:0036464	0.975	cytoplasmic ribonucleoprotein granule
GO:0010494	0.974	cytoplasmic stress granule
GO:1990904	0.970	ribonucleoprotein complex
GO:0005730	0.965	nucleolus
GO:0005654	0.556	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]