StarFunc result for job id Q9UNA0

User Input

>input (930 residues)
MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGH
PHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGT
SAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGR
VYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLD
QSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMARLYGRGLQHYLLTLASIANR
LYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYD
AAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQI
LGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGT
PCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPR
NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVL
PADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVRGKCVRTGCDGIIGSKLQYDK
CGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKK
NGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTV
QCQDGNRKLAKGCPLSQRPSAFKQCLLKKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R001	0.715	0.715	0.000	930	0.894	0.894	Q9R001.pdb.gz	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
2	AFDB:P97857	0.623	0.599	7.136E-103	968	0.410	0.394	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
3	AFDB:P59384	0.592	0.580	9.551E-96	950	0.405	0.397	P59384.pdb.gz	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
4	AFDB:P59510	0.584	0.295	2.428E-85	1910	0.326	0.159	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
5	AFDB:F1R6Q4	0.599	0.389	1.170E-84	1461	0.345	0.220	F1R6Q4.pdb.gz
6	AFDB:Q8BNJ2	0.608	0.675	1.977E-84	833	0.355	0.396	Q8BNJ2.pdb.gz	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
7	AFDB:Q9TT93	0.608	0.671	3.354E-83	839	0.348	0.386	Q9TT93.pdb.gz	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
8	AFDB:E9PUN6	0.596	0.296	3.549E-82	1931	0.349	0.168	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
9	AFDB:Q19791	0.598	0.266	6.770E-78	2150	0.313	0.135	Q19791.pdb.gz	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
10	AFDB:Q8TE60	0.568	0.439	9.937E-74	1221	0.302	0.230	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
11	PDB:4q1lA	0.194	0.831	9.025E-12	202	0.058	0.267	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:7ufgB	0.158	0.128	6.412E-6	1182	0.110	0.086	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:7ufgA	0.170	0.143	3.257E-5	1151	0.119	0.096	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:2x7mA	0.135	0.543	4.701E-5	180	0.042	0.217	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
15	PDB:4axqA	0.129	0.587	4.034E-4	163	0.032	0.184	4axqA.pdb.gz	Crystal Structures of Archaemetzincin Reveal a Moldable Substrate-Binding Site.
16	PDB:1w0rA	0.049	0.099	9.835E-4	442	0.057	0.120	1w0rA.pdb.gz
17	PDB:8a7eC	0.139	0.093	1.496E-3	1524	0.115	0.070	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:3afkA	0.078	0.295	4.741E-3	167	0.020	0.114	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
19	PDB:3wg3A	0.084	0.310	8.008E-3	163	0.016	0.092	3wg3A.pdb.gz	Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
20	PDB:4e0sB	0.063	0.065	8.893E-3	898	0.042	0.043	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V673	0.0	1642	927	0.885	0.888	G3V673_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=4 SV=1
2	P59384	0.0	693	950	0.392	0.384	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
3	P97857	0.0	706	968	0.397	0.381	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
4	Q6TY19	0.0	1642	928	0.887	0.889	Q6TY19_RAT ADAMTS5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=2 SV=1
5	Q8BNJ2	0.0	551	833	0.347	0.388	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
6	Q9R001	0.0	1653	930	0.885	0.885	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
7	Q9TT93	0.0	546	839	0.349	0.387	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
8	Q9UHI8	0.0	712	967	0.399	0.384	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
9	Q9UNA0	0.0	1932	930	1.000	1.000	ATS5_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Homo sapiens OX=9606 GN=ADAMTS5 PE=1 SV=2
10	Q9UP79	0.0	640	889	0.384	0.402	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
11	Q9WUQ1	0.0	711	967	0.409	0.393	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
12	O75173	1.06e-179	543	837	0.341	0.379	ATS4_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Homo sapiens OX=9606 GN=ADAMTS4 PE=1 SV=3
13	Q9ESP7	1.24e-179	535	630	0.301	0.444	ATS4_RAT A disintegrin and metalloproteinase with thrombospondin motifs 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Adamts4 PE=2 SV=2
14	P59511	2.41e-178	566	1906	0.340	0.166	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
15	P59510	2.31e-172	550	1910	0.335	0.163	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
16	Q9P2N4	2.64e-168	540	1935	0.338	0.162	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
17	E9PUN6	1.88e-164	529	1931	0.355	0.171	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
18	F1SFS3	1.46e-156	508	2000	0.365	0.170	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
19	Q9TT92	1.06e-145	432	207	0.218	0.981	ATS5_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 5 (Fragment) OS=Bos taurus OX=9913 GN=ADAMTS5 PE=2 SV=1
20	D3Z1A5	1.89e-140	449	1117	0.326	0.271	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	5.3e-18	76.6	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	2.3e-06	39.0	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	3.7e-28	109.5	ADAM-TS Spacer 1
4	PF16313 DUF4953	1.2e+02	13.3	Met-zincin
5	PF00413 Peptidase_M10	7.4	17.9	Matrixin
6	PF06114 Peptidase_M78	4.5e+02	12.2	IrrE N-terminal-like domain
7	PF01562 Pep_M12B_propep	2.6e-10	52.1	Reprolysin family propeptide
8	PF01421 Reprolysin	1.8e-20	85.3	Reprolysin (M12B) family zinc metalloprotease
9	PF13574 Reprolysin_2	0.00098	30.6	Metallo-peptidase family M12B Reprolysin-like
10	PF13582 Reprolysin_3	9.3e-11	53.7	Metallo-peptidase family M12B Reprolysin-like
11	PF13583 Reprolysin_4	0.0019	29.4	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	1.3e-10	53.3	Metallo-peptidase family M12
13	PF19030 TSP1_ADAMTS	5.3e-09	47.5	Thrombospondin type 1 domain
14	PF19035 TSP1_CCN	96	14.7	CCN3 Nov like TSP1 domain
15	PF19028 TSP1_spondin	0.0093	27.6	Spondin-like TSP1 domain
16	PF00090 TSP_1	0.00063	31.2	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284987

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.991	Aggrecan core protein
2	9606.ENSP00000331210	0.955	Brevican core protein
3	9606.ENSP00000343002	0.930	Beta-1,3-glucosyltransferase
4	9606.ENSP00000369921	0.930	ADAMTS-like protein 1
5	9606.ENSP00000339613	0.929	GDP-fucose protein O-fucosyltransferase 2
6	9606.ENSP00000355751	0.926	Thrombospondin-2
7	9606.ENSP00000251582	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 2
8	9606.ENSP00000260356	0.923	Thrombospondin-1
9	9606.ENSP00000286657	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 3
10	9606.ENSP00000460236	0.923	Spondin-1
11	9606.ENSP00000286744	0.921	ADAMTS-like protein 3
12	9606.ENSP00000247153	0.920	Properdin
13	9606.ENSP00000360997	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 13
14	9606.ENSP00000373472	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 7
15	9606.ENSP00000422554	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 12
16	9606.ENSP00000284984	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 1
17	9606.ENSP00000346478	0.918	ADAMTS-like protein 2
18	9606.ENSP00000358035	0.918	ADAMTS-like protein 4
19	9606.ENSP00000282849	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 18
20	9606.ENSP00000270328	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0050839	0.995	cell adhesion molecule binding
GO:1901681	0.979	sulfur compound binding
GO:0005539	0.910	glycosaminoglycan binding
GO:0050840	0.873	extracellular matrix binding
GO:0008201	0.853	heparin binding
GO:0005102	0.823	signaling receptor binding
GO:0005178	0.636	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.975	cellular process
GO:0048856	0.883	anatomical structure development
GO:0071704	0.721	organic substance metabolic process
GO:0044238	0.711	primary metabolic process
GO:0071840	0.685	cellular component organization or biogenesis
GO:0006807	0.683	nitrogen compound metabolic process
GO:0065007	0.681	biological regulation
GO:0050789	0.659	regulation of biological process
GO:0016043	0.654	cellular component organization
GO:0043170	0.643	macromolecule metabolic process
GO:1901564	0.616	organonitrogen compound metabolic process
GO:0019538	0.605	protein metabolic process
GO:0043062	0.602	extracellular structure organization
GO:0050794	0.566	regulation of cellular process
GO:0045229	0.549	external encapsulating structure organization
GO:0048513	0.522	animal organ development
GO:0009653	0.490	anatomical structure morphogenesis
GO:0032501	0.471	multicellular organismal process
GO:0030198	0.414	extracellular matrix organization
GO:0050896	0.411	response to stimulus
GO:0006508	0.403	proteolysis
GO:0022411	0.377	cellular component disassembly
GO:0007275	0.371	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0012505	0.998	endomembrane system
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005737	0.994	cytoplasm
GO:0071944	0.991	cell periphery
GO:0005783	0.933	endoplasmic reticulum
GO:0031012	0.930	extracellular matrix
GO:0005615	0.826	extracellular space
GO:0005788	0.805	endoplasmic reticulum lumen
GO:0062023	0.432	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]