StarFunc result for job id Q9UNA3

User Input

>input (340 residues)
MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSER
MEPPHLVSCSVESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLD
MKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEEN
FLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSAIWGNQGPELMTRMLRVWCKLED
FQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
IRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNA3	1.000	1.000	7.581E-72	340	1.000	1.000	Q9UNA3.pdb.gz	A4GCT_HUMAN Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
2	AFDB:Q14BT6	0.841	0.839	7.331E-57	341	0.712	0.710	Q14BT6.pdb.gz	A4GCT_MOUSE Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1
3	AFDB:Q9JI93	0.746	0.706	2.376E-30	360	0.344	0.325	Q9JI93.pdb.gz	A4GAT_RAT Lactosylceramide 4-alpha-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=A4galt PE=1 SV=1
4	AFDB:Q9NPC4	0.745	0.718	2.679E-30	353	0.329	0.317	Q9NPC4.pdb.gz	A4GAT_HUMAN Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
5	AFDB:Q9VBL5	0.706	0.612	1.941E-20	395	0.224	0.192	Q9VBL5.pdb.gz	Q9VBL5_DROME Alpha1,4-galactosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=alpha4GT2 PE=3 SV=3
6	AFDB:Q9VQK4	0.725	0.671	4.768E-20	369	0.226	0.209	Q9VQK4.pdb.gz	Q9VQK4_DROME Alpha1,4-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=alpha4GT1 PE=2 SV=1
7	AFDB:Q10323	0.412	0.395	1.788E-10	356	0.147	0.140	Q10323.pdb.gz	IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
8	AFDB:P38287	0.400	0.364	7.995E-10	376	0.132	0.120	P38287.pdb.gz	CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
9	AFDB:A0A1D8PIF7	0.431	0.280	2.214E-9	544	0.153	0.096	A0A1D8PIF7.pdb.gz	A0A1D8PIF7_CANAL Mannosylinositol phosphorylceramide synthase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIT1 PE=3 SV=1
10	AFDB:Q4WDG6	0.417	0.400	4.542E-9	356	0.124	0.118	Q4WDG6.pdb.gz	Q4WDG6_ASPFU MIPC synthase subunit (SurA), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G04680 PE=3 SV=1
11	PDB:8cvzI	0.443	0.538	1.562E-5	267	0.100	0.127	8cvzI.pdb.gz
12	PDB:1ll0B	0.354	0.433	7.416E-5	267	0.074	0.094	1ll0B.pdb.gz
13	PDB:6aciA	0.303	0.333	8.144E-4	304	0.126	0.141	6aciA.pdb.gz	Structural and Functional Insights into Host Death Domains Inactivation by the Bacterial Arginine GlcNAcyltransferase Effector.
14	PDB:6aguA	0.349	0.382	2.000E-3	304	0.109	0.122	6aguA.pdb.gz
15	PDB:4y63A	0.296	0.346	2.394E-3	282	0.071	0.085	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
16	PDB:5h63A	0.328	0.355	8.943E-3	309	0.135	0.149	5h63A.pdb.gz	Structural basis for arginine glycosylation of host substrates by bacterial effector proteins.
17	PDB:5vcsB	0.300	0.314	1.360E-2	323	0.065	0.068	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
18	PDB:6oq5A	0.306	0.051	1.533E-2	2346	0.100	0.014	6oq5A.pdb.gz	Structure of the full-length Clostridium difficile toxin B.
19	PDB:4decA	0.187	0.213	2.629E-2	284	0.068	0.081	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
20	PDB:7s05B	0.280	0.228	4.245E-2	437	0.076	0.059	7s05B.pdb.gz	Structure of the human GlcNAc-1-phosphotransferase alpha beta subunits reveals regulatory mechanism for lysosomal enzyme glycan phosphorylation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14BT6	0.0	536	341	0.712	0.710	A4GCT_MOUSE Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1
2	Q9UNA3	0.0	709	340	1.000	1.000	A4GCT_HUMAN Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
3	Q9JI93	2.30e-65	212	360	0.344	0.325	A4GAT_RAT Lactosylceramide 4-alpha-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=A4galt PE=1 SV=1
4	Q67BJ4	1.06e-64	210	359	0.338	0.320	A4GAT_MOUSE Lactosylceramide 4-alpha-galactosyltransferase OS=Mus musculus OX=10090 GN=A4galt PE=2 SV=1
5	Q9NPC4	1.30e-62	205	353	0.326	0.314	A4GAT_HUMAN Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
6	Q9VQK4	1.01e-25	107	369	0.206	0.190	Q9VQK4_DROME Alpha1,4-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=alpha4GT1 PE=2 SV=1
7	Q6KCK5	2.00e-24	103	357	0.203	0.193	Q6KCK5_DROME Alpha1,4-N-acetylgalactosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=alpha4GT1 PE=2 SV=1
8	Q9VBL5	8.15e-23	100	395	0.232	0.200	Q9VBL5_DROME Alpha1,4-galactosyltransferase 2 OS=Drosophila melanogaster OX=7227 GN=alpha4GT2 PE=3 SV=3
9	Q10323	1.17e-04	45.8	356	0.097	0.093	IMT3_SCHPO Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
10	O14084	0.001	42.4	319	0.065	0.069	IMT1_SCHPO Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
11	P38287	0.002	42.4	376	0.100	0.090	CSH1_YEAST Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
12	P33300	0.009	40.0	382	0.076	0.068	SUR1_YEAST Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
13	A0A1D8PIF7	0.097	37.0	544	0.059	0.037	A0A1D8PIF7_CANAL Mannosylinositol phosphorylceramide synthase catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIT1 PE=3 SV=1
14	A0A2R8YDE6	1.7	33.1	1160	0.044	0.013	A0A2R8YDE6_HUMAN Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=1
15	Q9UBN7	1.7	33.1	1215	0.044	0.012	HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=2
16	Q12797	3.5	32.0	758	0.118	0.053	ASPH_HUMAN Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3
17	C7BKP9	4.2	32.0	2957	0.053	0.006	PATOX_PHOAA Toxin PAU_02230 OS=Photorhabdus asymbiotica subsp. asymbiotica (strain ATCC 43949 / 3105-77) OX=553480 GN=PAU_02230 PE=1 SV=1
18	Q46149	4.9	31.6	2178	0.041	0.006	TCDA_CLONO Toxin A OS=Clostridium novyi OX=1542 GN=tcdA PE=1 SV=1
19	P12035	5.0	31.6	628	0.056	0.030	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
20	Q9UT67	5.2	31.2	345	0.053	0.052	IMT2_SCHPO Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04572 Gb3_synth	1.3e-42	156.5	Alpha 1,4-glycosyltransferase conserved region
2	PF04488 Gly_transf_sug	1.1e-20	85.4	Glycosyltransferase sugar-binding region containing DXD motif
3	PF12919 TcdA_TcdB	4.3e+02	11.6	TcdA/TcdB catalytic glycosyltransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406861	0.974	Mucin-6
2	9606.ENSP00000414350	0.954	Mucin-20
3	9606.ENSP00000485659	0.942	Mucin-5AC
4	9606.ENSP00000368771	0.925	Mucin-3A
5	9606.ENSP00000416753	0.919	Mucin-15
6	9606.ENSP00000436812	0.918	Mucin-5B
7	9606.ENSP00000381008	0.915	Mucin-16
8	9606.ENSP00000485028	0.915	Mucin-13
9	9606.ENSP00000407422	0.914	Mucin-7
10	9606.ENSP00000484824	0.912	Mucin-1
11	9606.ENSP00000417498	0.909	Mucin-4
12	9606.ENSP00000302716	0.904	Mucin-17
13	9606.ENSP00000365473	0.904	Mucin-21
14	9606.ENSP00000311364	0.900	Mucin-like protein 1
15	9606.ENSP00000441929	0.900	Mucin-12
16	9606.ENSP00000317027	0.788	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
17	9606.ENSP00000379377	0.745	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
18	9606.ENSP00000355162	0.674	Tigger transposable element-derived protein 4
19	9606.ENSP00000420333	0.654	Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1
20	9606.ENSP00000002596	0.637	Heparan sulfate glucosamine 3-O-sulfotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0005488	0.416	binding
GO:0005515	0.338	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901135	0.997	carbohydrate derivative metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1901566	0.995	organonitrogen compound biosynthetic process
GO:0006493	0.986	protein O-linked glycosylation
GO:0005975	0.703	carbohydrate metabolic process
GO:0050789	0.307	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.997	Golgi membrane
GO:0071944	0.526	cell periphery
GO:0005886	0.513	plasma membrane
GO:0070013	0.440	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]