StarFunc result for job id Q9UNE7

User Input

>input (303 residues)
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVA
VYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRA
YSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEEC
QRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELM
REPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWV
EDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A4T0	0.946	0.943	2.144E-43	304	0.977	0.974	D4A4T0.pdb.gz	D4A4T0_RAT STIP1 homology and U-box containing protein 1 OS=Rattus norvegicus OX=10116 GN=Stub1 PE=1 SV=1
2	PDB:2c2lA	0.539	0.575	6.996E-34	281	0.908	0.979	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
3	AFDB:Q9XYW6	0.895	0.938	4.613E-30	289	0.528	0.554	Q9XYW6.pdb.gz	Q9XYW6_DROME Carboxy terminus of Hsp70-interacting protein OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=2 SV=1
4	AFDB:G5ECY6	0.728	0.818	1.152E-20	266	0.356	0.406	G5ECY6.pdb.gz	G5ECY6_CAEEL Hsp70-interacting protein OS=Caenorhabditis elegans OX=6239 GN=chn-1 PE=1 SV=1
5	AFDB:Q9SRS9	0.710	0.766	3.509E-19	278	0.294	0.320	Q9SRS9.pdb.gz	CHIP_ARATH E3 ubiquitin-protein ligase CHIP OS=Arabidopsis thaliana OX=3702 GN=CHIP PE=1 SV=1
6	AFDB:F4ICB5	0.372	0.234	3.175E-9	491	0.165	0.102	F4ICB5.pdb.gz	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1
7	AFDB:O70593	0.404	0.391	3.775E-8	314	0.178	0.172	O70593.pdb.gz	SGTA_RAT Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Rattus norvegicus OX=10116 GN=Sgta PE=1 SV=1
8	AFDB:O43765	0.410	0.397	2.033E-7	313	0.178	0.173	O43765.pdb.gz	SGTA_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1
9	AFDB:Q9MUK5	0.370	0.191	2.245E-7	593	0.132	0.067	Q9MUK5.pdb.gz	TOC64_PEA Translocon at the outer membrane of chloroplasts 64 OS=Pisum sativum OX=3888 GN=TOC64 PE=1 SV=1
10	AFDB:Q9VJD4	0.376	0.345	2.604E-7	331	0.135	0.124	Q9VJD4.pdb.gz	Q9VJD4_DROME LD24721p OS=Drosophila melanogaster OX=7227 GN=Sgt PE=1 SV=1
11	AFDB:Q15785	0.363	0.356	2.875E-7	309	0.125	0.123	Q15785.pdb.gz	TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2
12	PDB:7kw7E	0.369	0.343	3.006E-6	327	0.162	0.150	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:7obeA	0.370	0.239	3.850E-6	480	0.119	0.075	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
14	PDB:3m62A	0.237	0.078	1.787E-5	955	0.175	0.055	3m62A.pdb.gz
15	PDB:1ihgA	0.374	0.313	2.178E-5	364	0.109	0.091	1ihgA.pdb.gz
16	PDB:4nrhB	0.324	0.556	3.237E-5	170	0.056	0.100	4nrhB.pdb.gz
17	PDB:1wao1	0.349	0.229	3.574E-5	471	0.116	0.074	1wao1.pdb.gz	Molecular Basis for Tpr Domain-Mediated Regulation of Protein Phosphatase 5
18	PDB:7qe7J	0.375	0.226	4.811E-5	510	0.125	0.075	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:3wxxG	0.349	0.674	5.311E-5	151	0.063	0.126	3wxxG.pdb.gz	Structure of AcrH-AopB Chaperone-Translocator Complex Reveals a Role for Membrane Hairpins in Type III Secretion System Translocon Assembly
20	PDB:5njxA	0.408	0.305	6.803E-5	413	0.119	0.087	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZPA4	0.0	512	267	0.809	0.918	A0A8I5ZPA4_RAT STIP1 homology and U-box containing protein 1 OS=Rattus norvegicus OX=10116 GN=Stub1 PE=1 SV=1
2	D4A4T0	0.0	612	304	0.977	0.974	D4A4T0_RAT STIP1 homology and U-box containing protein 1 OS=Rattus norvegicus OX=10116 GN=Stub1 PE=1 SV=1
3	Q9UNE7	0.0	629	303	1.000	1.000	CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2
4	Q9WUD1	0.0	610	304	0.977	0.974	CHIP_MOUSE E3 ubiquitin-protein ligase CHIP OS=Mus musculus OX=10090 GN=Stub1 PE=1 SV=1
5	H3BS86	5.32e-151	423	213	0.703	1.000	H3BS86_HUMAN STIP1 homology and U-box containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=8
6	I6L9H8	8.79e-142	400	224	0.650	0.879	I6L9H8_RAT Stub1 protein OS=Rattus norvegicus OX=10116 GN=Stub1 PE=2 SV=1
7	H3BUD0	2.60e-120	344	185	0.564	0.924	H3BUD0_HUMAN STIP1 homology and U-box containing protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2
8	Q9XYW6	2.93e-117	340	289	0.531	0.557	Q9XYW6_DROME Carboxy terminus of Hsp70-interacting protein OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=2 SV=1
9	Q86DT6	4.64e-90	269	221	0.419	0.575	Q86DT6_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1
10	Q86DT5	9.95e-90	268	221	0.419	0.575	Q86DT5_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1
11	Q86DT7	9.95e-90	268	221	0.419	0.575	Q86DT7_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1
12	Q86DT8	9.95e-90	268	221	0.419	0.575	Q86DT8_DROME Hsp70-interacting protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=STUB1 PE=4 SV=1
13	G5ECY6	3.42e-66	210	266	0.373	0.425	G5ECY6_CAEEL Hsp70-interacting protein OS=Caenorhabditis elegans OX=6239 GN=chn-1 PE=1 SV=1
14	Q9SRS9	5.85e-49	166	278	0.310	0.338	CHIP_ARATH E3 ubiquitin-protein ligase CHIP OS=Arabidopsis thaliana OX=3702 GN=CHIP PE=1 SV=1
15	Q57ZX0	1.10e-14	76.3	550	0.132	0.073	Q57ZX0_TRYB2 Stress-induced protein sti1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.210 PE=4 SV=1
16	Q43468	5.78e-14	74.3	572	0.125	0.066	HSOP1_SOYBN Hsp70-Hsp90 organizing protein 1 OS=Glycine max OX=3847 GN=HOP1 PE=1 SV=2
17	Q80W98	6.97e-14	72.8	304	0.142	0.141	SGTB_RAT Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Rattus norvegicus OX=10116 GN=Sgtb PE=1 SV=1
18	Q96EQ0	4.26e-13	70.5	304	0.139	0.138	SGTB_HUMAN Small glutamine-rich tetratricopeptide repeat-containing protein beta OS=Homo sapiens OX=9606 GN=SGTB PE=1 SV=1
19	Q9STH1	1.09e-12	70.5	558	0.122	0.066	HSOP3_ARATH Hsp70-Hsp90 organizing protein 3 OS=Arabidopsis thaliana OX=3702 GN=HOP3 PE=2 SV=1
20	F8RP11	1.24e-12	70.5	581	0.122	0.064	HSOP_WHEAT Hsp70-Hsp90 organizing protein OS=Triticum aestivum OX=4565 GN=HOP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	5.1e-09	47.6	Anaphase-promoting complex, cyclosome, subunit 3
2	PF18391 CHIP_TPR_N	6.7e-23	92.6	CHIP N-terminal tetratricopeptide repeat domain
3	PF10516 SHNi-TPR	1.1e+02	13.7	SHNi-TPR
4	PF00515 TPR_1	1.7e-14	64.1	Tetratricopeptide repeat
5	PF13374 TPR_10	5.9e+02	11.8	Tetratricopeptide repeat
6	PF13414 TPR_11	1.2e-05	36.2	TPR repeat
7	PF13424 TPR_12	0.00011	33.7	Tetratricopeptide repeat
8	PF13428 TPR_14	0.44	22.5	Tetratricopeptide repeat
9	PF13432 TPR_16	4.2e-08	44.9	Tetratricopeptide repeat
10	PF13431 TPR_17	0.00084	30.6	Tetratricopeptide repeat
11	PF14559 TPR_19	0.024	26.4	Tetratricopeptide repeat
12	PF07719 TPR_2	2.5e-10	50.7	Tetratricopeptide repeat
13	PF13174 TPR_6	0.5	22.2	Tetratricopeptide repeat
14	PF13176 TPR_7	0.26	22.4	Tetratricopeptide repeat
15	PF13181 TPR_8	1.2e-06	39.3	Tetratricopeptide repeat
16	PF13371 TPR_9	1	20.8	Tetratricopeptide repeat
17	PF04564 U-box	2.2e-27	106.3	U-box domain
18	PF15906 zf-NOSIP	2.4e+02	13.3	Zinc-finger of nitric oxide synthase-interacting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009975

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000015709	0.998	Heat shock 70kDa protein 4
2	61853.ENSNLEP00000014947	0.995	Ubiquitin-conjugating enzyme E2D 1
3	61853.ENSNLEP00000006897	0.993	Ubiquitin-conjugating enzyme E2N
4	61853.ENSNLEP00000009039	0.992	Belongs to the heat shock protein 70 family.
5	61853.ENSNLEP00000019365	0.986	Heat shock protein 90kDa alpha (cytosolic), class A member 1
6	61853.ENSNLEP00000006298	0.967	BCL2-associated athanogene
7	61853.ENSNLEP00000013874	0.962	Heat shock protein 90kDa alpha (cytosolic), class B member 1
8	61853.ENSNLEP00000020325	0.953	BCL2-associated athanogene 3
9	61853.ENSNLEP00000007762	0.943	Uncharacterized protein
10	61853.ENSNLEP00000018707	0.935	Estrogen receptor
11	61853.ENSNLEP00000020791	0.933	Ataxin 3
12	61853.ENSNLEP00000000665	0.930	Uncharacterized protein
13	61853.ENSNLEP00000015443	0.928	Interferon regulatory factor 1
14	61853.ENSNLEP00000001285	0.923	Receptor protein-tyrosine kinase
15	61853.ENSNLEP00000014239	0.917	Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis. Mediates the transport of chloride ions across the cell membrane (By similarity). Channel activity is coupled to ATP hydrolysis. The ion channel is also permeable to HCO(3-)
16	61853.ENSNLEP00000011861	0.916	Cellular tumor antigen p53
17	61853.ENSNLEP00000005820	0.915	Microtubule-associated protein tau
18	61853.ENSNLEP00000022450	0.900	Uncharacterized protein
19	61853.ENSNLEP00000023098	0.900	Ubiquitin-conjugating enzyme E2D 3
20	61853.ENSNLEP00000022021	0.896	Ubiquitin-conjugating enzyme E2D 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019787	0.999	ubiquitin-like protein transferase activity
GO:0051087	0.997	chaperone binding
GO:0031072	0.997	heat shock protein binding
GO:0004842	0.994	ubiquitin-protein transferase activity
GO:0019899	0.988	enzyme binding
GO:0044389	0.979	ubiquitin-like protein ligase binding
GO:0061659	0.966	ubiquitin-like protein ligase activity
GO:0031625	0.966	ubiquitin protein ligase binding
GO:0061630	0.958	ubiquitin protein ligase activity
GO:0030544	0.915	Hsp70 protein binding
GO:0042802	0.899	identical protein binding
GO:0060090	0.888	molecular adaptor activity
GO:0046983	0.859	protein dimerization activity
GO:0042803	0.835	protein homodimerization activity
GO:0030674	0.703	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:0009056	0.992	catabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:1901564	0.982	organonitrogen compound metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0051716	0.978	cellular response to stimulus
GO:0065007	0.977	biological regulation
GO:0050789	0.969	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0019538	0.950	protein metabolic process
GO:1901565	0.948	organonitrogen compound catabolic process
GO:0006950	0.926	response to stress
GO:0060255	0.918	regulation of macromolecule metabolic process
GO:0080090	0.913	regulation of primary metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0042221	0.898	response to chemical
GO:0030163	0.895	protein catabolic process
GO:0070887	0.863	cellular response to chemical stimulus
GO:0033554	0.855	cellular response to stress
GO:0048518	0.840	positive regulation of biological process
GO:0036211	0.809	protein modification process
GO:0009893	0.783	positive regulation of metabolic process
GO:0044248	0.753	cellular catabolic process
GO:0010604	0.696	positive regulation of macromolecule metabolic process
GO:0070647	0.679	protein modification by small protein conjugation or removal
GO:0048522	0.674	positive regulation of cellular process
GO:0032446	0.673	protein modification by small protein conjugation
GO:0016567	0.650	protein ubiquitination
GO:0051246	0.638	regulation of protein metabolic process
GO:0031323	0.635	regulation of cellular metabolic process
GO:0051173	0.623	positive regulation of nitrogen compound metabolic process
GO:0051247	0.594	positive regulation of protein metabolic process
GO:0048519	0.560	negative regulation of biological process
GO:0048523	0.458	negative regulation of cellular process
GO:0007154	0.452	cell communication
GO:0023052	0.446	signaling
GO:0031325	0.426	positive regulation of cellular metabolic process
GO:0048583	0.419	regulation of response to stimulus
GO:0065009	0.418	regulation of molecular function
GO:0007165	0.416	signal transduction
GO:0023051	0.397	regulation of signaling
GO:0009966	0.386	regulation of signal transduction
GO:0031399	0.359	regulation of protein modification process
GO:0000209	0.349	protein polyubiquitination
GO:0031396	0.335	regulation of protein ubiquitination
GO:0010033	0.326	response to organic substance
GO:0006511	0.313	ubiquitin-dependent protein catabolic process
GO:0071310	0.312	cellular response to organic substance
GO:0031401	0.311	positive regulation of protein modification process
GO:0010498	0.311	proteasomal protein catabolic process
GO:0043161	0.301	proteasome-mediated ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.997	protein-containing complex
GO:0005829	0.996	cytosol
GO:0005654	0.993	nucleoplasm
GO:0140535	0.977	intracellular protein-containing complex
GO:1902494	0.976	catalytic complex
GO:0012505	0.917	endomembrane system
GO:1990234	0.908	transferase complex
GO:0043232	0.900	intracellular non-membrane-bounded organelle
GO:0031371	0.853	ubiquitin conjugating enzyme complex
GO:0016020	0.593	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]