StarFunc result for job id Q9UNF0

User Input

>input (486 residues)
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QY17	0.640	0.638	1.572E-63	488	0.936	0.932	Q9QY17.pdb.gz	PACN2_RAT Protein kinase C and casein kinase substrate in neurons 2 protein OS=Rattus norvegicus OX=10116 GN=Pacsin2 PE=1 SV=2
2	AFDB:A0A0R4IHF0	0.727	0.719	1.214E-50	491	0.656	0.650	A0A0R4IHF0.pdb.gz	A0A0R4IHF0_DANRE Protein kinase C and casein kinase substrate in neurons 2 OS=Danio rerio OX=7955 GN=zgc:77519 PE=1 SV=1
3	AFDB:Q9BY11	0.624	0.681	2.867E-50	444	0.617	0.676	Q9BY11.pdb.gz	PACN1_HUMAN Protein kinase C and casein kinase substrate in neurons protein 1 OS=Homo sapiens OX=9606 GN=PACSIN1 PE=1 SV=1
4	AFDB:Q4V920	0.647	0.705	9.384E-49	445	0.603	0.658	Q4V920.pdb.gz	PACN1_DANRE Protein kinase C and casein kinase substrate in neurons protein 1 OS=Danio rerio OX=7955 GN=pacsin1b PE=1 SV=1
5	AFDB:B0R118	0.624	0.695	1.705E-44	435	0.519	0.579	B0R118.pdb.gz
6	AFDB:Q5I2Z0	0.617	0.704	1.577E-43	424	0.502	0.575	Q5I2Z0.pdb.gz	Q5I2Z0_RAT Protein kinase C and casein kinase substrate in neurons 3 OS=Rattus norvegicus OX=10116 GN=Pacsin3 PE=1 SV=1
7	AFDB:A0A0B4KH28	0.617	0.606	3.170E-39	495	0.442	0.434	A0A0B4KH28.pdb.gz	A0A0B4KH28_DROME Syndapin, isoform C OS=Drosophila melanogaster OX=7227 GN=Synd PE=1 SV=1
8	PDB:3hajA	0.571	0.959	1.490E-36	286	0.586	0.997	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
9	AFDB:Q6AHQ8	0.585	0.575	3.168E-28	495	0.321	0.315	Q6AHQ8.pdb.gz	Q6AHQ8_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sdpn-1 PE=1 SV=1
10	AFDB:Q75JD4	0.391	0.364	1.157E-19	533	0.193	0.176	Q75JD4.pdb.gz	Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271676 PE=4 SV=1
11	AFDB:A0A0S2Z5P3	0.362	0.413	6.605E-18	416	0.177	0.207	A0A0S2Z5P3.pdb.gz	A0A0S2Z5P3_HUMAN Proline-serine-threonine phosphatase interacting protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=2 SV=1
12	PDB:6ikoA	0.382	0.578	7.227E-9	303	0.095	0.152	6ikoA.pdb.gz
13	PDB:1k9aB	0.118	0.130	1.528E-4	441	0.039	0.043	1k9aB.pdb.gz
14	PDB:3qwyA	0.121	0.334	3.262E-4	170	0.035	0.100	3qwyA.pdb.gz
15	PDB:3ehqA	0.118	0.306	3.994E-4	182	0.047	0.126	3ehqA.pdb.gz
16	PDB:1griA	0.118	0.266	6.621E-4	211	0.047	0.109	1griA.pdb.gz
17	PDB:2dybA	0.114	0.184	8.525E-4	298	0.035	0.057	2dybA.pdb.gz
18	PDB:2lqnA	0.117	0.184	2.013E-3	303	0.029	0.046	2lqnA.pdb.gz
19	PDB:2h8hA	0.105	0.115	2.727E-3	445	0.041	0.045	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:2eyzA	0.115	0.181	4.298E-3	304	0.045	0.072	2eyzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IHF0	0.0	618	491	0.638	0.631	A0A0R4IHF0_DANRE Protein kinase C and casein kinase substrate in neurons 2 OS=Danio rerio OX=7955 GN=zgc:77519 PE=1 SV=1
2	A0A0U1RR22	0.0	929	451	0.924	0.996	A0A0U1RR22_HUMAN Protein kinase C and casein kinase substrate in neurons 2 (Fragment) OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=1
3	F1QC13	0.0	615	490	0.650	0.645	F1QC13_DANRE Protein kinase C and casein kinase substrate in neurons 2 OS=Danio rerio OX=7955 GN=zgc:77519 PE=1 SV=1
4	Q4V920	0.0	599	445	0.601	0.656	PACN1_DANRE Protein kinase C and casein kinase substrate in neurons protein 1 OS=Danio rerio OX=7955 GN=pacsin1b PE=1 SV=1
5	Q61644	0.0	629	441	0.634	0.698	PACN1_MOUSE Protein kinase C and casein kinase substrate in neurons protein 1 OS=Mus musculus OX=10090 GN=Pacsin1 PE=1 SV=1
6	Q9BY11	0.0	637	444	0.640	0.700	PACN1_HUMAN Protein kinase C and casein kinase substrate in neurons protein 1 OS=Homo sapiens OX=9606 GN=PACSIN1 PE=1 SV=1
7	Q9QY17	0.0	950	488	0.936	0.932	PACN2_RAT Protein kinase C and casein kinase substrate in neurons 2 protein OS=Rattus norvegicus OX=10116 GN=Pacsin2 PE=1 SV=2
8	Q9UNF0	0.0	1014	486	1.000	1.000	PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2
9	Q9WVE8	0.0	957	486	0.938	0.938	PACN2_MOUSE Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus OX=10090 GN=Pacsin2 PE=1 SV=1
10	Q9Z0W5	0.0	627	441	0.634	0.698	PACN1_RAT Protein kinase C and casein kinase substrate in neurons protein 1 OS=Rattus norvegicus OX=10116 GN=Pacsin1 PE=1 SV=1
11	Q99JB8	5.70e-172	492	424	0.504	0.578	PACN3_MOUSE Protein kinase C and casein kinase II substrate protein 3 OS=Mus musculus OX=10090 GN=Pacsin3 PE=1 SV=1
12	Q9UKS6	3.16e-171	490	424	0.500	0.573	PACN3_HUMAN Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2
13	Q5I2Z0	1.77e-170	488	424	0.500	0.573	Q5I2Z0_RAT Protein kinase C and casein kinase substrate in neurons 3 OS=Rattus norvegicus OX=10116 GN=Pacsin3 PE=1 SV=1
14	A0A0C4DGG1	1.87e-160	462	405	0.477	0.573	A0A0C4DGG1_HUMAN Protein kinase C and casein kinase substrate in neurons 3 (Fragment) OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=1
15	Q7ZUY8	8.58e-146	424	377	0.397	0.512	Q7ZUY8_DANRE Protein kinase C and casein kinase substrate in neurons 3 OS=Danio rerio OX=7955 GN=zgc:56324 PE=1 SV=1
16	A0A0B4KH28	5.52e-136	403	495	0.449	0.440	A0A0B4KH28_DROME Syndapin, isoform C OS=Drosophila melanogaster OX=7227 GN=Synd PE=1 SV=1
17	Q9VDI1	1.08e-135	402	494	0.451	0.443	Q9VDI1_DROME LD46328p OS=Drosophila melanogaster OX=7227 GN=Synd PE=1 SV=2
18	Q09989	1.22e-72	239	489	0.331	0.329	Q09989_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sdpn-1 PE=1 SV=2
19	Q6AHQ8	1.79e-72	239	495	0.331	0.325	Q6AHQ8_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sdpn-1 PE=1 SV=1
20	Q555L8	2.83e-13	73.6	389	0.146	0.183	Y4695_DICDI SH3 and F-BAR domain-containing protein DDB_G0274695 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274695 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05384 DegS	1.6e+02	13.2	Sensor protein DegS
2	PF00611 FCH	3.7e-13	61.0	Fes/CIP4, and EFC/F-BAR homology domain
3	PF16601 NPF	0.44	22.5	Rabosyn-5 repeating NPF sequence-motif
4	PF05276 SH3BP5	5.7e+02	11.6	SH3 domain-binding protein 5 (SH3BP5)
5	PF00018 SH3_1	3.4e-12	57.1	SH3 domain
6	PF07653 SH3_2	0.00037	31.6	Variant SH3 domain
7	PF14604 SH3_9	1.4e-11	55.5	Variant SH3 domain
8	PF04906 Tweety	8.9e+02	9.9	Tweety

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223023	0.982	Neural Wiskott-Aldrich syndrome protein
2	9606.ENSP00000373905	0.972	Dynamin-2
3	9606.ENSP00000484060	0.951	Protein kinase C and casein kinase substrate in neurons protein 1
4	9606.ENSP00000440945	0.950	Protein kinase C and casein kinase substrate in neurons protein 3
5	9606.ENSP00000378912	0.921	Protein cordon-bleu
6	9606.ENSP00000341360	0.887	Cordon-bleu WH2 repeat protein like 1
7	9606.ENSP00000215957	0.870	MICAL-like protein 1
8	9606.ENSP00000479153	0.846	EH domain-containing protein 1
9	9606.ENSP00000327116	0.821	EH domain-containing protein 3
10	9606.ENSP00000263277	0.811	EH domain-containing protein 2
11	9606.ENSP00000349541	0.744	Caveolae-associated protein 1
12	9606.ENSP00000362014	0.734	Dynamin-1
13	9606.ENSP00000320117	0.726	Cdc42-interacting protein 4
14	9606.ENSP00000413625	0.704	Formin-binding protein 1
15	9606.ENSP00000429900	0.679	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
16	9606.ENSP00000344465	0.678	Platelet endothelial aggregation receptor 1
17	9606.ENSP00000348602	0.667	Amphiphysin
18	9606.ENSP00000227507	0.658	G1/S-specific cyclin-D1
19	9606.ENSP00000348912	0.647	Disintegrin and metalloproteinase domain-containing protein 33
20	9606.ENSP00000393776	0.641	F-BAR domain only protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	0.999	lipid binding
GO:0005515	0.999	protein binding
GO:0042802	0.960	identical protein binding
GO:0005543	0.945	phospholipid binding
GO:0050839	0.585	cell adhesion molecule binding
GO:0045296	0.557	cadherin binding
GO:0043168	0.390	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0061024	0.998	membrane organization
GO:0010256	0.996	endomembrane system organization
GO:0007009	0.990	plasma membrane organization
GO:0051179	0.907	localization
GO:0050789	0.888	regulation of biological process
GO:0006996	0.834	organelle organization
GO:0050794	0.825	regulation of cellular process
GO:0044085	0.598	cellular component biogenesis
GO:0051641	0.561	cellular localization
GO:0006810	0.489	transport
GO:0050896	0.443	response to stimulus
GO:0016192	0.443	vesicle-mediated transport
GO:0022607	0.414	cellular component assembly
GO:0006897	0.358	endocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0005829	0.987	cytosol
GO:0043226	0.960	organelle
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0030054	0.945	cell junction
GO:0005634	0.872	nucleus
GO:0031982	0.827	vesicle
GO:0070013	0.759	intracellular organelle lumen
GO:0031981	0.665	nuclear lumen
GO:0098590	0.637	plasma membrane region
GO:0005654	0.601	nucleoplasm
GO:0030659	0.409	cytoplasmic vesicle membrane
GO:0012505	0.407	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]