StarFunc result for job id Q9UNG2

User Input

>input (199 residues)
MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFL
CSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY
GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV
LKNNTYWGIILLANPQFIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNG2	1.000	1.000	1.281E-34	199	1.000	1.000	Q9UNG2.pdb.gz	TNF18_HUMAN Tumor necrosis factor ligand superfamily member 18 OS=Homo sapiens OX=9606 GN=TNFSF18 PE=1 SV=3
2	AFDB:Q7TS55	0.573	0.655	1.847E-17	173	0.452	0.520	Q7TS55.pdb.gz	TNF18_MOUSE Tumor necrosis factor ligand superfamily member 18 OS=Mus musculus OX=10090 GN=Tnfsf18 PE=1 SV=1
3	PDB:7e57B	0.548	0.867	2.646E-13	123	0.337	0.545	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
4	AFDB:P32972	0.363	0.308	5.842E-7	239	0.186	0.155	P32972.pdb.gz	TNFL8_MOUSE Tumor necrosis factor ligand superfamily member 8 OS=Mus musculus OX=10090 GN=Tnfsf8 PE=2 SV=1
5	AFDB:B9ENV6	0.450	0.350	6.861E-7	264	0.166	0.125	B9ENV6.pdb.gz	B9ENV6_SALSA CD40 ligand OS=Salmo salar OX=8030 GN=CD40L PE=2 SV=1
6	AFDB:A9CDZ0	0.403	0.349	9.985E-7	233	0.171	0.146	A9CDZ0.pdb.gz	A9CDZ0_PIG B-cell activating factor OS=Sus scrofa OX=9823 PE=2 SV=1
7	AFDB:Q4W897	0.455	0.447	1.306E-6	203	0.181	0.177	Q4W897.pdb.gz	Q4W897_DANRE Lymphotoxin alpha OS=Danio rerio OX=7955 GN=TNF-N PE=2 SV=1
8	AFDB:D2DMJ8	0.432	0.432	1.377E-6	199	0.141	0.141	D2DMJ8.pdb.gz	D2DMJ8_DANRE A proliferation-inducing ligand-like protein OS=Danio rerio OX=7955 GN=april PE=2 SV=1
9	AFDB:P48023	0.431	0.318	1.801E-6	281	0.176	0.125	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
10	AFDB:A0A0U5J7Q1	0.392	0.284	2.484E-6	285	0.186	0.130	A0A0U5J7Q1.pdb.gz	A0A0U5J7Q1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=TNLG7A PE=2 SV=1
11	AFDB:P29965	0.470	0.366	4.987E-6	261	0.196	0.149	P29965.pdb.gz	CD40L_HUMAN CD40 ligand OS=Homo sapiens OX=9606 GN=CD40LG PE=1 SV=1
12	PDB:5h4bA	0.408	0.572	4.388E-4	136	0.075	0.110	5h4bA.pdb.gz
13	PDB:5kc6B	0.394	0.526	2.574E-3	144	0.065	0.090	5kc6B.pdb.gz
14	PDB:5jovA	0.255	0.064	6.755E-3	949	0.065	0.014	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
15	PDB:7l2zF	0.266	0.097	2.197E-2	664	0.055	0.017	7l2zF.pdb.gz
16	PDB:7qe7L	0.141	0.152	2.318E-2	183	0.055	0.060	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:2waaA	0.256	0.167	3.559E-2	335	0.060	0.036	2waaA.pdb.gz
18	PDB:1o59A	0.124	0.088	4.180E-2	318	0.045	0.028	1o59A.pdb.gz
19	PDB:1kfxL	0.205	0.084	6.772E-2	640	0.065	0.020	1kfxL.pdb.gz
20	PDB:1o4tA	0.203	0.312	7.145E-2	115	0.045	0.078	1o4tA.pdb.gz	Crystal structure of a putative oxalate decarboxylase (TM1287) from Thermotoga maritima at 1.95 A resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UNG2	6.95e-132	369	177	0.889	1.000	TNF18_HUMAN Tumor necrosis factor ligand superfamily member 18 OS=Homo sapiens OX=9606 GN=TNFSF18 PE=1 SV=3
2	Q7TS55	9.09e-45	148	173	0.452	0.520	TNF18_MOUSE Tumor necrosis factor ligand superfamily member 18 OS=Mus musculus OX=10090 GN=Tnfsf18 PE=1 SV=1
3	A6PVC3	2.0	31.2	223	0.070	0.063	A6PVC3_HUMAN Modulator of VRAC current 1 (Fragment) OS=Homo sapiens OX=9606 GN=MLC1 PE=1 SV=1
4	Q15049	2.9	30.8	377	0.070	0.037	MLC1_HUMAN Membrane protein MLC1 OS=Homo sapiens OX=9606 GN=MLC1 PE=1 SV=5
5	B0YIF1	5.9	30.0	359	0.075	0.042	B0YIF1_DANRE Ectodysplasin OS=Danio rerio OX=7955 GN=si:ch73-223d24.5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	3.8	18.9	TNF(Tumour Necrosis Factor) family
2	PF10601 zf-LITAF-like	5.2e+02	12.3	LITAF-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328207	0.999	Tumor necrosis factor receptor superfamily member 18
2	9606.ENSP00000281834	0.696	Tumor necrosis factor ligand superfamily member 4
3	9606.ENSP00000245817	0.682	Tumor necrosis factor ligand superfamily member 9
4	9606.ENSP00000011653	0.644	T-cell surface glycoprotein CD4
5	9606.ENSP00000471604	0.642	Testis-expressed protein 13A
6	9606.ENSP00000245903	0.640	CD70 antigen
7	9606.ENSP00000354912	0.636	Melanoma-associated antigen E1
8	9606.ENSP00000368538	0.631	Tumor necrosis factor receptor superfamily member 4
9	9606.ENSP00000354660	0.622	Melanoma-associated antigen C2
10	9606.ENSP00000430950	0.615	Indoleamine 2,3-dioxygenase 1
11	9606.ENSP00000478699	0.615	Tumor necrosis factor receptor superfamily member 9
12	9606.ENSP00000162749	0.610	Tumor necrosis factor receptor superfamily member 1A
13	9606.ENSP00000303939	0.604	Cytotoxic T-lymphocyte protein 4
14	9606.ENSP00000339477	0.580	Inducible T-cell co-stimulator ligand
15	9606.ENSP00000483732	0.580	ICOS ligand
16	9606.ENSP00000386559	0.565	T-cell surface glycoprotein CD8 alpha chain
17	9606.ENSP00000223795	0.561	Tumor necrosis factor ligand superfamily member 8
18	9606.ENSP00000363157	0.560	Tumor necrosis factor ligand superfamily member 15
19	9606.ENSP00000365380	0.523	Forkhead box protein P3
20	9606.ENSP00000347948	0.521	Tumor necrosis factor receptor superfamily member 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.616	cytokine receptor binding
GO:0032813	0.324	tumor necrosis factor receptor superfamily binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0009987	0.989	cellular process
GO:0023052	0.983	signaling
GO:0002684	0.979	positive regulation of immune system process
GO:0007165	0.970	signal transduction
GO:0030155	0.965	regulation of cell adhesion
GO:0010604	0.958	positive regulation of macromolecule metabolic process
GO:0051246	0.950	regulation of protein metabolic process
GO:0048522	0.938	positive regulation of cellular process
GO:0031323	0.932	regulation of cellular metabolic process
GO:0048519	0.928	negative regulation of biological process
GO:0010941	0.926	regulation of cell death
GO:0048523	0.922	negative regulation of cellular process
GO:0051247	0.905	positive regulation of protein metabolic process
GO:0045785	0.901	positive regulation of cell adhesion
GO:0043067	0.825	regulation of programmed cell death
GO:0031401	0.824	positive regulation of protein modification process
GO:0042981	0.773	regulation of apoptotic process
GO:0001934	0.766	positive regulation of protein phosphorylation
GO:0051239	0.672	regulation of multicellular organismal process
GO:0050730	0.555	regulation of peptidyl-tyrosine phosphorylation
GO:0050865	0.535	regulation of cell activation
GO:0051249	0.532	regulation of lymphocyte activation
GO:0002376	0.506	immune system process
GO:0050731	0.496	positive regulation of peptidyl-tyrosine phosphorylation
GO:0042127	0.491	regulation of cell population proliferation
GO:0042509	0.484	regulation of tyrosine phosphorylation of STAT protein
GO:0042531	0.471	positive regulation of tyrosine phosphorylation of STAT protein
GO:0050863	0.465	regulation of T cell activation
GO:0032944	0.458	regulation of mononuclear cell proliferation
GO:0007267	0.429	cell-cell signaling
GO:0010468	0.413	regulation of gene expression
GO:0050670	0.413	regulation of lymphocyte proliferation
GO:0048583	0.393	regulation of response to stimulus
GO:0051240	0.362	positive regulation of multicellular organismal process
GO:0007166	0.356	cell surface receptor signaling pathway
GO:2000145	0.352	regulation of cell motility
GO:0022407	0.347	regulation of cell-cell adhesion
GO:0048584	0.336	positive regulation of response to stimulus
GO:1903037	0.330	regulation of leukocyte cell-cell adhesion
GO:2000147	0.330	positive regulation of cell motility
GO:0030334	0.319	regulation of cell migration
GO:0042129	0.311	regulation of T cell proliferation
GO:0030335	0.305	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.516	cell surface
GO:0043227	0.363	membrane-bounded organelle
GO:0043229	0.317	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]