StarFunc result for job id Q9UNK9

User Input

>input (670 residues)
MIASCLCYLLLPATRLFRALSDAFFTCRKNVLLANSSSPQVEGDFAMAPRGPEQEECEGL
LQQWREEGLSQVLSTASEGPLIDKGLAQSSLALLMDNPGEENAASEDRWSSRQLSDLRAA
ENLDEPFPEMLGEEPLLEVEGVEGSMWAAIPMQSEPQYADCAALPVGALATEQWEEDPAV
LAWSIAPEPVPQEEASIWPFEGLGQLQPPAVEIPYHEILWREWEDFSTQPDAQGLKAGDG
PQFQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFVNLMQEFQHWDPDILCLQEVQ
EDHYWEQLEPSLRMMGFTCFYKRRTGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLN
RDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAILLAEVDKVARL
SDGSHCPIILCGDLNSVPDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPL
WPSSLGITDCCQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPE
RPAGWAESVLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMT
VDYIFFSAESCENGNRTDHRLYRDGTLKLLGRLSLLSEEILWAANGLPNPFCSSDHLCLL
ASFGMEVTAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6B2	0.708	0.708	0.000	670	1.000	1.000	A0A024R6B2.pdb.gz
2	AFDB:Q5VTE6	0.535	0.654	7.038E-55	544	0.330	0.406	Q5VTE6.pdb.gz	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1
3	AFDB:F4J8R6	0.441	0.650	8.050E-33	449	0.201	0.301	F4J8R6.pdb.gz	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
4	PDB:7ax1A	0.410	0.524	3.109E-25	518	0.157	0.203	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
5	AFDB:F1N588	0.290	0.316	4.000E-10	612	0.145	0.158	F1N588.pdb.gz	F1N588_BOVIN sphingomyelin phosphodiesterase OS=Bos taurus OX=9913 GN=SMPD2 PE=1 SV=2
6	PDB:4f1iA	0.272	0.522	3.273E-9	328	0.072	0.146	4f1iA.pdb.gz
7	PDB:1akoA	0.254	0.569	7.744E-8	268	0.090	0.224	1akoA.pdb.gz
8	PDB:4awnA	0.210	0.476	2.537E-7	260	0.052	0.135	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
9	PDB:7kiuA	0.188	0.424	5.287E-7	263	0.039	0.099	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
10	PDB:2a3zB	0.189	0.425	8.791E-7	260	0.037	0.096	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
11	PDB:6o1kA	0.248	0.539	3.047E-6	262	0.073	0.187	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
12	PDB:2imqX	0.230	0.472	8.914E-6	280	0.069	0.164	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
13	PDB:7cd5A	0.265	0.566	9.432E-6	278	0.076	0.183	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
14	PDB:2o3cB	0.247	0.529	1.756E-5	280	0.075	0.179	2o3cB.pdb.gz
15	AFDB:Q54D97	0.220	0.117	7.118E-1	1379	0.081	0.039	Q54D97.pdb.gz	Q54D97_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P3 PE=4 SV=1
16	AFDB:Q3SXY8	0.062	0.088	1.402	428	0.039	0.061	Q3SXY8.pdb.gz	AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens OX=9606 GN=ARL13B PE=1 SV=1
17	AFDB:Q6SJ96	0.059	0.089	1.968	375	0.079	0.141	Q6SJ96.pdb.gz	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
18	AFDB:Q8SX40	0.054	0.077	2.923	439	0.051	0.077	Q8SX40.pdb.gz	Q8SX40_DROME RE19693p OS=Drosophila melanogaster OX=7227 GN=Nnk PE=2 SV=1
19	AFDB:O43088	0.058	0.080	3.092	452	0.043	0.064	O43088.pdb.gz	RBA50_SCHPO RNA polymerase II-associated protein rba50 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rba50 PE=3 SV=1
20	AFDB:P77173	0.051	0.099	3.092	328	0.066	0.134	P77173.pdb.gz	ZIPA_ECOLI Cell division protein ZipA OS=Escherichia coli (strain K12) OX=83333 GN=zipA PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UNK9	0.0	1378	670	1.000	1.000	ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens OX=9606 GN=ANGEL1 PE=1 SV=1
2	Q5VTE6	5.35e-117	362	544	0.307	0.379	ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens OX=9606 GN=ANGEL2 PE=1 SV=1
3	Q8VYU4	2.05e-41	163	754	0.139	0.123	CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana OX=3702 GN=CCR4-6 PE=2 SV=2
4	F4J8R6	2.32e-34	138	449	0.134	0.200	F4J8R6_ARATH DNAse I-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CCR4C PE=1 SV=1
5	Q8VEG6	3.39e-28	121	555	0.112	0.135	CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2
6	H0Y9C1	1.55e-27	118	435	0.110	0.170	H0Y9C1_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
7	H0Y9Z5	1.23e-26	117	550	0.110	0.135	H0Y9Z5_HUMAN poly(A)-specific ribonuclease OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
8	Q96LI5	1.44e-26	116	555	0.110	0.133	CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens OX=9606 GN=CNOT6L PE=1 SV=2
9	Q8W0Z9	1.80e-26	117	602	0.125	0.140	CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CCR4-1 PE=2 SV=1
10	Q9ULM6	1.50e-24	110	557	0.119	0.144	CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2
11	Q9VCB6	5.09e-23	105	545	0.127	0.156	Q9VCB6_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=2
12	Q8MTZ5	6.71e-23	105	566	0.127	0.150	Q8MTZ5_DROME poly(A)-specific ribonuclease (Fragment) OS=Drosophila melanogaster OX=7227 GN=twin PE=2 SV=1
13	Q7K112	6.79e-23	105	552	0.127	0.154	Q7K112_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
14	P31384	7.14e-23	106	837	0.121	0.097	CCR4_YEAST CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCR4 PE=1 SV=2
15	Q8IMX1	7.31e-23	105	567	0.127	0.150	Q8IMX1_DROME poly(A)-specific ribonuclease OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
16	Q3TIU4	8.98e-23	105	608	0.110	0.122	PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus OX=10090 GN=Pde12 PE=1 SV=2
17	Q8IMX0	3.45e-22	100	358	0.122	0.229	Q8IMX0_DROME Twin, isoform D OS=Drosophila melanogaster OX=7227 GN=twin PE=1 SV=1
18	Q6L8Q7	3.98e-22	103	609	0.110	0.122	PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2
19	O74874	4.39e-22	103	690	0.112	0.109	CCR4_SCHPO CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr4 PE=1 SV=1
20	Q08DF7	1.24e-21	101	609	0.110	0.122	PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus OX=9913 GN=PDE12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	1.3e-42	157.6	Endonuclease/Exonuclease/phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000425561	0.840	Eukaryotic translation initiation factor 4E
2	9606.ENSP00000430493	0.798	CCR4-NOT transcription complex subunit 8
3	9606.ENSP00000167106	0.773	Vasohibin-1
4	9606.ENSP00000306396	0.763	E3 ubiquitin-protein ligase RNF187
5	9606.ENSP00000355279	0.725	CCR4-NOT transcription complex subunit 7
6	9606.ENSP00000356985	0.717	Death effector domain-containing protein
7	9606.ENSP00000294964	0.644	Extracellular tyrosine-protein kinase PKDCC
8	9606.ENSP00000261534	0.643	Protein O-mannosyl-transferase 2
9	9606.ENSP00000278198	0.634	Leucine-rich repeat-containing protein 4C
10	9606.ENSP00000233047	0.631	Promethin
11	9606.ENSP00000242249	0.618	Receptor activity-modifying protein 3
12	9606.ENSP00000229195	0.602	CCR4-NOT transcription complex subunit 2
13	9606.ENSP00000387911	0.590	Poly(A)-specific ribonuclease PARN
14	9606.ENSP00000306117	0.580	ATP-dependent RNA helicase DDX19A
15	9606.ENSP00000361162	0.574	Target of EGR1 protein 1
16	9606.ENSP00000320949	0.557	CCR4-NOT transcription complex subunit 1
17	9606.ENSP00000273064	0.542	CCR4-NOT transcription complex subunit 9
18	9606.ENSP00000238682	0.540	Transforming growth factor beta-3
19	9606.ENSP00000303992	0.539	Transmembrane protein 43
20	9606.ENSP00000363298	0.516	B box and SPRY domain-containing protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0008190	1.000	eukaryotic initiation factor 4E binding
GO:0003824	0.571	catalytic activity
GO:0016787	0.526	hydrolase activity
GO:0016788	0.505	hydrolase activity, acting on ester bonds
GO:0004518	0.368	nuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0008152	0.996	metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0050794	0.979	regulation of cellular process
GO:0034641	0.967	cellular nitrogen compound metabolic process
GO:0046483	0.951	heterocycle metabolic process
GO:0019222	0.950	regulation of metabolic process
GO:0031323	0.944	regulation of cellular metabolic process
GO:0043170	0.941	macromolecule metabolic process
GO:0048519	0.932	negative regulation of biological process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0006139	0.927	nucleobase-containing compound metabolic process
GO:0080090	0.923	regulation of primary metabolic process
GO:0048523	0.922	negative regulation of cellular process
GO:0019219	0.908	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.886	regulation of gene expression
GO:0048518	0.868	positive regulation of biological process
GO:0010605	0.820	negative regulation of macromolecule metabolic process
GO:0051252	0.794	regulation of RNA metabolic process
GO:0009893	0.780	positive regulation of metabolic process
GO:0031324	0.696	negative regulation of cellular metabolic process
GO:0051172	0.695	negative regulation of nitrogen compound metabolic process
GO:0009894	0.546	regulation of catabolic process
GO:0031329	0.518	regulation of cellular catabolic process
GO:0065008	0.493	regulation of biological quality
GO:0010604	0.468	positive regulation of macromolecule metabolic process
GO:0090304	0.454	nucleic acid metabolic process
GO:0010608	0.433	post-transcriptional regulation of gene expression
GO:0016070	0.431	RNA metabolic process
GO:1903311	0.393	regulation of mRNA metabolic process
GO:0048522	0.371	positive regulation of cellular process
GO:0010556	0.346	regulation of macromolecule biosynthetic process
GO:0031326	0.316	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048471	1.000	perinuclear region of cytoplasm
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005801	0.999	cis-Golgi network
GO:0005783	0.998	endoplasmic reticulum
GO:0016020	0.512	membrane
GO:0070013	0.460	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.526	Hydrolases.
EC:3.1.-.-	0.505	Acting on ester bonds.

[back to server]