StarFunc result for job id Q9UNL4

User Input

>input (249 residues)
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE
KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGS
VHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP
RCSQERKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C0D7	0.893	0.893	6.371E-39	249	0.992	0.992	Q8C0D7.pdb.gz	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
2	AFDB:Q4VBS0	0.836	0.833	9.893E-34	250	0.823	0.820	Q4VBS0.pdb.gz	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
3	AFDB:Q8WYH8	0.557	0.576	1.064E-28	240	0.707	0.733	Q8WYH8.pdb.gz	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
4	AFDB:Q9VJY8	0.535	0.474	2.185E-24	285	0.542	0.474	Q9VJY8.pdb.gz	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
5	AFDB:Q54PN9	0.456	0.355	1.954E-19	324	0.430	0.330	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
6	AFDB:Q9QXV3	0.400	0.359	2.209E-19	279	0.382	0.341	Q9QXV3.pdb.gz	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
7	AFDB:Q9ESK4	0.396	0.353	2.978E-17	281	0.345	0.306	Q9ESK4.pdb.gz	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
8	AFDB:Q9LIQ6	0.515	0.544	7.670E-16	234	0.289	0.308	Q9LIQ6.pdb.gz	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
9	AFDB:Q9NXR8	0.434	0.273	3.141E-15	418	0.369	0.220	Q9NXR8.pdb.gz	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
10	AFDB:Q5AHB8	0.412	0.348	1.644E-14	298	0.293	0.245	Q5AHB8.pdb.gz	YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YNG2 PE=3 SV=2
11	PDB:7vvuV	0.389	0.805	1.506E-4	113	0.092	0.204	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
12	PDB:6tuyA	0.247	0.108	1.201E-1	667	0.044	0.016	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
13	PDB:4n78F	0.369	0.564	1.277E-1	156	0.072	0.115	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
14	PDB:6z6oC	0.275	0.149	1.277E-1	548	0.084	0.038	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
15	PDB:1serB	0.170	0.112	1.844E-1	421	0.064	0.038	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
16	PDB:4q4aA	0.398	0.182	1.844E-1	572	0.036	0.016	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
17	PDB:5u1dB	0.335	0.161	1.844E-1	552	0.064	0.029	5u1dB.pdb.gz
18	PDB:6cnnA	0.304	0.214	1.844E-1	360	0.060	0.042	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
19	PDB:5bw9g	0.188	0.314	2.085E-1	141	0.068	0.121	5bw9g.pdb.gz
20	PDB:3k29A	0.382	0.558	2.216E-1	162	0.076	0.117	3k29A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C0D7	0.0	517	249	0.992	0.992	ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus OX=10090 GN=Ing4 PE=1 SV=2
2	Q9UNL4	0.0	520	249	1.000	1.000	ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens OX=9606 GN=ING4 PE=1 SV=1
3	Q4VBS0	8.78e-154	429	250	0.823	0.820	Q4VBS0_DANRE Inhibitor of growth protein OS=Danio rerio OX=7955 GN=wu:fb11d09 PE=2 SV=1
4	Q9D8Y8	3.59e-121	346	240	0.683	0.708	ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus OX=10090 GN=Ing5 PE=1 SV=1
5	Q8WYH8	2.19e-117	337	240	0.699	0.725	ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens OX=9606 GN=ING5 PE=1 SV=1
6	Q9VJY8	5.87e-85	256	285	0.562	0.491	ING5_DROME Inhibitor of growth protein 5 OS=Drosophila melanogaster OX=7227 GN=Ing5 PE=1 SV=2
7	Q9QXV3	1.10e-56	184	279	0.386	0.344	ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus OX=10090 GN=Ing1 PE=2 SV=1
8	Q9ESK4	7.09e-45	154	281	0.329	0.292	ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus OX=10090 GN=Ing2 PE=1 SV=3
9	Q9H160	3.57e-43	149	280	0.333	0.296	ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens OX=9606 GN=ING2 PE=1 SV=2
10	Q9LIQ6	1.51e-39	138	234	0.329	0.350	ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana OX=3702 GN=ING1 PE=1 SV=1
11	Q9UK53	8.85e-39	141	422	0.317	0.187	ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2
12	B3H615	1.95e-37	134	262	0.341	0.324	ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1
13	Q54PN9	6.32e-32	121	324	0.185	0.142	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
14	E7ET07	1.90e-28	113	403	0.161	0.099	E7ET07_HUMAN Inhibitor of growth protein OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=1
15	Q9NXR8	2.42e-28	113	418	0.161	0.096	ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens OX=9606 GN=ING3 PE=1 SV=2
16	Q9VEF5	2.60e-25	105	433	0.153	0.088	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
17	O42871	1.11e-24	101	283	0.313	0.276	ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=png1 PE=3 SV=1
18	F4HWW1	9.20e-24	99.4	328	0.293	0.223	F4HWW1_ARATH PHD finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=ING2 PE=1 SV=1
19	Q9VWS0	5.06e-23	99.8	686	0.133	0.048	Q9VWS0_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Ing3 PE=1 SV=1
20	Q5AHB8	2.34e-22	95.1	298	0.297	0.248	YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YNG2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20090 DUF6482	2.4e+02	13.1	Family of unknown function (DUF6482)
2	PF12507 HCMV_UL139	2.2e+02	13.6	Human Cytomegalovirus UL139 protein
3	PF12998 ING	6.6e-29	111.8	Inhibitor of growth proteins N-terminal histone-binding
4	PF00628 PHD	0.0079	27.4	PHD-finger
5	PF13831 PHD_2	5.2	17.9	PHD-finger
6	PF11365 SOGA	2.1e+02	14.4	Protein SOGA
7	PF13771 zf-HC5HC2H	38	15.9	PHD-like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005441

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014063	0.986	MYST/Esa1-associated factor 6
2	61853.ENSNLEP00000003949	0.977	K(lysine) acetyltransferase 7
3	61853.ENSNLEP00000011861	0.958	Cellular tumor antigen p53
4	61853.ENSNLEP00000015494	0.953	K(lysine) acetyltransferase 6A
5	61853.ENSNLEP00000020448	0.952	K(lysine) acetyltransferase 6B
6	61853.ENSNLEP00000011003	0.951	Bromodomain and PHD finger containing, 3
7	61853.ENSNLEP00000005007	0.946	Bromodomain and PHD finger containing, 1
8	61853.ENSNLEP00000016981	0.946	DNA methyltransferase 1 associated protein 1
9	61853.ENSNLEP00000004637	0.945	YEATS domain containing 4
10	61853.ENSNLEP00000010671	0.941	Mortality factor 4 like 1
11	61853.ENSNLEP00000001635	0.938	Bromodomain containing 1
12	61853.ENSNLEP00000009893	0.932	Jade family PHD finger 2
13	61853.ENSNLEP00000011131	0.917	Enhancer of polycomb homolog 2 (Drosophila)
14	61853.ENSNLEP00000022030	0.917	Enhancer of polycomb homolog 1 (Drosophila)
15	61853.ENSNLEP00000016918	0.880	Jade family PHD finger 1
16	61853.ENSNLEP00000003395	0.868	AT rich interactive domain 4B (RBP1-like)
17	61853.ENSNLEP00000023853	0.868	AT rich interactive domain 4A (RBP1-like)
18	61853.ENSNLEP00000007056	0.856	Actin-like 6A
19	61853.ENSNLEP00000017307	0.847	RuvB-like helicase
20	61853.ENSNLEP00000003575	0.840	Jade family PHD finger 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.842	catalytic activity
GO:0140096	0.822	catalytic activity, acting on a protein
GO:0042393	0.791	histone binding
GO:0140030	0.773	modification-dependent protein binding
GO:0140034	0.719	methylation-dependent protein binding
GO:0035064	0.705	methylated histone binding
GO:0004402	0.688	histone acetyltransferase activity
GO:0003676	0.450	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048522	0.990	positive regulation of cellular process
GO:0009987	0.977	cellular process
GO:0071704	0.915	organic substance metabolic process
GO:0044238	0.910	primary metabolic process
GO:0006807	0.895	nitrogen compound metabolic process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0080090	0.877	regulation of primary metabolic process
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0043170	0.869	macromolecule metabolic process
GO:0031323	0.869	regulation of cellular metabolic process
GO:0010941	0.867	regulation of cell death
GO:0019219	0.863	regulation of nucleobase-containing compound metabolic process
GO:0042981	0.845	regulation of apoptotic process
GO:0010556	0.750	regulation of macromolecule biosynthetic process
GO:0031326	0.749	regulation of cellular biosynthetic process
GO:0048519	0.735	negative regulation of biological process
GO:0048523	0.717	negative regulation of cellular process
GO:0036211	0.715	protein modification process
GO:0010468	0.689	regulation of gene expression
GO:0010942	0.632	positive regulation of cell death
GO:0051252	0.622	regulation of RNA metabolic process
GO:0009893	0.574	positive regulation of metabolic process
GO:0016570	0.561	histone modification
GO:2001141	0.559	regulation of RNA biosynthetic process
GO:0071840	0.547	cellular component organization or biogenesis
GO:0006355	0.547	regulation of DNA-templated transcription
GO:0031325	0.543	positive regulation of cellular metabolic process
GO:0043065	0.543	positive regulation of apoptotic process
GO:0018205	0.541	peptidyl-lysine modification
GO:0051173	0.540	positive regulation of nitrogen compound metabolic process
GO:0010604	0.508	positive regulation of macromolecule metabolic process
GO:0016043	0.499	cellular component organization
GO:0051052	0.470	regulation of DNA metabolic process
GO:0018393	0.465	internal peptidyl-lysine acetylation
GO:0016573	0.464	histone acetylation
GO:0048583	0.457	regulation of response to stimulus
GO:0050896	0.420	response to stimulus
GO:0043967	0.417	histone H4 acetylation
GO:0006325	0.414	chromatin organization
GO:0009892	0.408	negative regulation of metabolic process
GO:0010605	0.401	negative regulation of macromolecule metabolic process
GO:0031324	0.378	negative regulation of cellular metabolic process
GO:0045935	0.365	positive regulation of nucleobase-containing compound metabolic process
GO:0051726	0.336	regulation of cell cycle
GO:0051172	0.336	negative regulation of nitrogen compound metabolic process
GO:0080135	0.305	regulation of cellular response to stress
GO:0051128	0.303	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005829	0.975	cytosol
GO:0000785	0.918	chromatin
GO:1990234	0.905	transferase complex
GO:0140535	0.900	intracellular protein-containing complex
GO:0000123	0.870	histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	0.688	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.688	histone acetyltransferase.

[back to server]