StarFunc result for job id Q9UNN5

User Input

>input (650 residues)
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNN5	1.000	1.000	0.000	650	1.000	1.000	Q9UNN5.pdb.gz	FAF1_HUMAN FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 PE=1 SV=2
2	AFDB:Q8JGN2	0.474	0.455	5.710E-101	681	0.797	0.761	Q8JGN2.pdb.gz
3	AFDB:Q7JUP3	0.424	0.400	4.414E-61	695	0.368	0.344	Q7JUP3.pdb.gz	Q7JUP3_DROME Caspar, isoform A OS=Drosophila melanogaster OX=7227 GN=casp PE=1 SV=1
4	AFDB:H2L056	0.463	0.487	1.025E-33	613	0.266	0.282	H2L056.pdb.gz	UBXN3_CAEEL UBX domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=ubxn-3 PE=1 SV=1
5	AFDB:Q9M0N1	0.284	0.373	8.705E-24	480	0.198	0.269	Q9M0N1.pdb.gz	PUX10_ARATH Plant UBX domain-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=PUX10 PE=2 SV=1
6	AFDB:Q3TDN2	0.380	0.524	1.675E-22	445	0.174	0.254	Q3TDN2.pdb.gz	FAF2_MOUSE FAS-associated factor 2 OS=Mus musculus OX=10090 GN=Faf2 PE=1 SV=2
7	AFDB:O74498	0.342	0.484	8.741E-18	427	0.118	0.180	O74498.pdb.gz	UCP10_SCHPO UBX domain-containing protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp10 PE=3 SV=1
8	AFDB:Q38CY2	0.239	0.448	9.265E-16	315	0.102	0.210	Q38CY2.pdb.gz	Q38CY2_TRYB2 UBX domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2680 PE=4 SV=1
9	AFDB:Q12229	0.253	0.333	2.655E-14	455	0.117	0.167	Q12229.pdb.gz	UBX3_YEAST UBX domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX3 PE=1 SV=1
10	AFDB:Q04228	0.280	0.300	1.344E-12	584	0.103	0.115	Q04228.pdb.gz	UBX2_YEAST UBX domain-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX2 PE=1 SV=1
11	PDB:6yvaC	0.111	0.429	7.973E-10	155	0.038	0.161	6yvaC.pdb.gz
12	PDB:7rbsB	0.112	0.430	1.369E-8	157	0.038	0.159	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
13	PDB:6mdhA	0.138	0.453	7.125E-8	149	0.037	0.161	6mdhA.pdb.gz
14	PDB:6pyuA	0.109	0.078	2.639E-5	930	0.032	0.023	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
15	PDB:7lq1A	0.104	0.072	5.222E-5	950	0.031	0.021	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5dxhD	0.103	0.073	5.851E-5	981	0.048	0.032	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
17	PDB:7c3mA	0.117	0.129	9.222E-5	577	0.043	0.049	7c3mA.pdb.gz
18	PDB:6hd0D	0.101	0.779	1.454E-4	75	0.028	0.240	6hd0D.pdb.gz	Common Mode of Remodeling AAA ATPases p97/CDC48 by Their Disassembling Cofactors ASPL/PUX1.
19	PDB:2y3aA	0.108	0.074	1.825E-4	976	0.037	0.025	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.
20	PDB:5itdA	0.105	0.070	2.425E-4	995	0.040	0.026	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0UXY9	0.0	1004	675	0.788	0.759	B0UXY9_DANRE FAS-associated factor 1 OS=Danio rerio OX=7955 GN=fc25h12 PE=1 SV=1
2	P54731	0.0	1287	649	0.963	0.965	FAF1_MOUSE FAS-associated factor 1 OS=Mus musculus OX=10090 GN=Faf1 PE=1 SV=2
3	Q9UNN5	0.0	1350	650	1.000	1.000	FAF1_HUMAN FAS-associated factor 1 OS=Homo sapiens OX=9606 GN=FAF1 PE=1 SV=2
4	A0A0B4LFH2	6.77e-123	382	690	0.380	0.358	A0A0B4LFH2_DROME Caspar, isoform C OS=Drosophila melanogaster OX=7227 GN=casp PE=1 SV=1
5	Q7JUP3	3.05e-122	380	695	0.375	0.351	Q7JUP3_DROME Caspar, isoform A OS=Drosophila melanogaster OX=7227 GN=casp PE=1 SV=1
6	H2L056	1.87e-35	144	613	0.172	0.183	UBXN3_CAEEL UBX domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=ubxn-3 PE=1 SV=1
7	Q9M0N1	1.42e-25	112	480	0.143	0.194	PUX10_ARATH Plant UBX domain-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=PUX10 PE=2 SV=1
8	Q96CS3	1.46e-20	97.4	445	0.140	0.204	FAF2_HUMAN FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2
9	Q3TDN2	1.93e-20	97.1	445	0.122	0.178	FAF2_MOUSE FAS-associated factor 2 OS=Mus musculus OX=10090 GN=Faf2 PE=1 SV=2
10	A0A087WV67	6.24e-08	56.6	270	0.052	0.126	A0A087WV67_HUMAN UBX domain protein 8 OS=Homo sapiens OX=9606 GN=UBXN8 PE=1 SV=1
11	O00124	6.77e-08	56.6	270	0.052	0.126	UBXN8_HUMAN UBX domain-containing protein 8 OS=Homo sapiens OX=9606 GN=UBXN8 PE=1 SV=2
12	C9JAT7	6.98e-08	57.0	327	0.049	0.098	C9JAT7_HUMAN UBX domain protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=1
13	O94888	9.81e-08	57.4	489	0.049	0.065	UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens OX=9606 GN=UBXN7 PE=1 SV=2
14	A0A087WT23	1.62e-07	55.8	310	0.052	0.110	A0A087WT23_HUMAN UBX domain protein 8 OS=Homo sapiens OX=9606 GN=UBXN8 PE=1 SV=1
15	Q12229	1.05e-06	53.9	455	0.112	0.160	UBX3_YEAST UBX domain-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX3 PE=1 SV=1
16	O74498	1.23e-06	53.5	427	0.100	0.152	UCP10_SCHPO UBX domain-containing protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp10 PE=3 SV=1
17	F4JPR7	1.60e-06	53.5	564	0.085	0.098	PUX8_ARATH Plant UBX domain-containing protein 8 OS=Arabidopsis thaliana OX=3702 GN=PUX8 PE=1 SV=1
18	Q8IDX6	0.006	42.4	3130	0.055	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
19	Q92575	0.019	40.4	508	0.034	0.043	UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2
20	A0A087WTZ5	0.031	38.9	238	0.043	0.118	A0A087WTZ5_HUMAN UBX domain protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14555 UBA_4	8e-05	33.7	UBA-like domain
2	PF00240 ubiquitin	0.83	20.8	Ubiquitin family
3	PF14560 Ubiquitin_2	59	15.6	Ubiquitin-like domain
4	PF00789 UBX	5e-19	79.6	UBX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379457

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.999	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000263202	0.994	Ubiquitin recognition factor in ER-associated degradation protein 1
3	9606.ENSP00000351273	0.994	Caspase-8
4	9606.ENSP00000331487	0.993	Nuclear protein localization protein 4 homolog
5	9606.ENSP00000347979	0.992	Tumor necrosis factor receptor superfamily member 6
6	9606.ENSP00000301838	0.986	FAS-associated death domain protein
7	9606.ENSP00000294119	0.976	UBX domain-containing protein 1
8	9606.ENSP00000356694	0.930	Tumor necrosis factor ligand superfamily member 6
9	9606.ENSP00000363668	0.924	Death domain-associated protein 6
10	9606.ENSP00000394794	0.923	Tyrosine-protein phosphatase non-receptor type 13
11	9606.ENSP00000410402	0.919	Dual specificity mitogen-activated protein kinase kinase 4
12	9606.ENSP00000296328	0.913	UBX domain-containing protein 7
13	9606.ENSP00000341268	0.910	Tumor necrosis factor receptor type 1-associated DEATH domain protein
14	9606.ENSP00000302961	0.907	Heat shock protein family A member 4
15	9606.ENSP00000312455	0.905	CASP8 and FADD-like apoptosis regulator
16	9606.ENSP00000220751	0.904	Receptor-interacting serine/threonine-protein kinase 2
17	9606.ENSP00000358327	0.902	Caspase-7
18	9606.ENSP00000286186	0.900	Caspase-10
19	9606.ENSP00000229214	0.899	KRR1 small subunit processome component homolog
20	9606.ENSP00000441543	0.882	Polyubiquitin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.996	enzyme binding
GO:0032182	0.995	ubiquitin-like protein binding
GO:0043130	0.994	ubiquitin binding
GO:0031625	0.994	ubiquitin protein ligase binding
GO:0019900	0.938	kinase binding
GO:0051059	0.935	NF-kappaB binding
GO:0031072	0.930	heat shock protein binding
GO:0019901	0.930	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.971	cellular process
GO:0048518	0.966	positive regulation of biological process
GO:0048522	0.956	positive regulation of cellular process
GO:0010942	0.908	positive regulation of cell death
GO:0019222	0.844	regulation of metabolic process
GO:0048519	0.837	negative regulation of biological process
GO:2001236	0.831	regulation of extrinsic apoptotic signaling pathway
GO:0023056	0.824	positive regulation of signaling
GO:0010647	0.822	positive regulation of cell communication
GO:0060255	0.813	regulation of macromolecule metabolic process
GO:0009967	0.801	positive regulation of signal transduction
GO:0048523	0.767	negative regulation of cellular process
GO:0051246	0.763	regulation of protein metabolic process
GO:0031323	0.747	regulation of cellular metabolic process
GO:0008152	0.742	metabolic process
GO:0051173	0.732	positive regulation of nitrogen compound metabolic process
GO:0051179	0.699	localization
GO:0010604	0.687	positive regulation of macromolecule metabolic process
GO:0065009	0.682	regulation of molecular function
GO:1902041	0.666	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0071704	0.660	organic substance metabolic process
GO:0019219	0.643	regulation of nucleobase-containing compound metabolic process
GO:0043065	0.626	positive regulation of apoptotic process
GO:0050896	0.616	response to stimulus
GO:0030155	0.606	regulation of cell adhesion
GO:0044087	0.563	regulation of cellular component biogenesis
GO:0044237	0.559	cellular metabolic process
GO:0044092	0.539	negative regulation of molecular function
GO:0010468	0.537	regulation of gene expression
GO:0051641	0.526	cellular localization
GO:0043170	0.526	macromolecule metabolic process
GO:0051716	0.515	cellular response to stimulus
GO:0044238	0.510	primary metabolic process
GO:2001235	0.502	positive regulation of apoptotic signaling pathway
GO:0006807	0.496	nitrogen compound metabolic process
GO:0031326	0.484	regulation of cellular biosynthetic process
GO:0010556	0.481	regulation of macromolecule biosynthetic process
GO:0051252	0.476	regulation of RNA metabolic process
GO:0051247	0.451	positive regulation of protein metabolic process
GO:0033036	0.437	macromolecule localization
GO:0008104	0.410	protein localization
GO:0031325	0.401	positive regulation of cellular metabolic process
GO:0051128	0.390	regulation of cellular component organization
GO:0019538	0.385	protein metabolic process
GO:2001141	0.347	regulation of RNA biosynthetic process
GO:0071840	0.340	cellular component organization or biogenesis
GO:0006950	0.340	response to stress
GO:0006355	0.338	regulation of DNA-templated transcription
GO:0044260	0.315	cellular macromolecule metabolic process
GO:0009894	0.308	regulation of catabolic process
GO:0042221	0.300	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0016020	0.998	membrane
GO:0005654	0.998	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0005829	0.992	cytosol
GO:0031090	0.982	organelle membrane
GO:0005783	0.881	endoplasmic reticulum
GO:0098796	0.865	membrane protein complex
GO:0031984	0.748	organelle subcompartment
GO:0042175	0.741	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.732	endoplasmic reticulum membrane
GO:0140534	0.691	endoplasmic reticulum protein-containing complex
GO:0034098	0.554	VCP-NPL4-UFD1 AAA ATPase complex
GO:0048471	0.457	perinuclear region of cytoplasm
GO:0031975	0.451	envelope
GO:0031967	0.414	organelle envelope
GO:0005635	0.323	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]