StarFunc result for job id Q9UNN8

User Input

>input (238 residues)
MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
PPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
FLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNN8	1.000	1.000	6.002E-45	238	1.000	1.000	Q9UNN8.pdb.gz	EPCR_HUMAN Endothelial protein C receptor OS=Homo sapiens OX=9606 GN=PROCR PE=1 SV=1
2	AFDB:Q4V8I1	0.753	0.744	1.396E-31	241	0.639	0.631	Q4V8I1.pdb.gz	EPCR_RAT Endothelial protein C receptor OS=Rattus norvegicus OX=10116 GN=Procr PE=2 SV=1
3	AFDB:Q64695	0.727	0.715	3.013E-30	242	0.672	0.661	Q64695.pdb.gz	EPCR_MOUSE Endothelial protein C receptor OS=Mus musculus OX=10090 GN=Procr PE=1 SV=3
4	AFDB:A0A669KB34	0.679	0.669	6.750E-14	242	0.248	0.244	A0A669KB34.pdb.gz	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
5	AFDB:P15813	0.665	0.482	3.012E-12	335	0.214	0.152	P15813.pdb.gz	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
6	AFDB:P06126	0.647	0.485	5.568E-12	327	0.189	0.138	P06126.pdb.gz	CD1A_HUMAN T-cell surface glycoprotein CD1a OS=Homo sapiens OX=9606 GN=CD1A PE=1 SV=4
7	AFDB:P29017	0.653	0.479	6.226E-12	333	0.185	0.132	P29017.pdb.gz	CD1C_HUMAN T-cell surface glycoprotein CD1c OS=Homo sapiens OX=9606 GN=CD1C PE=1 SV=2
8	AFDB:P15812	0.645	0.408	2.516E-11	388	0.193	0.119	P15812.pdb.gz	CD1E_HUMAN T-cell surface glycoprotein CD1e, membrane-associated OS=Homo sapiens OX=9606 GN=CD1E PE=1 SV=2
9	AFDB:V9GXR0	0.639	0.596	4.159E-11	257	0.155	0.144	V9GXR0.pdb.gz	V9GXR0_MOUSE Histocompatibility 2, blastocyst OS=Mus musculus OX=10090 GN=H2-Bl PE=3 SV=1
10	AFDB:P29016	0.645	0.474	4.918E-11	333	0.185	0.132	P29016.pdb.gz	CD1B_HUMAN T-cell surface glycoprotein CD1b OS=Homo sapiens OX=9606 GN=CD1B PE=1 SV=1
11	PDB:1cd1A	0.643	0.565	9.008E-10	273	0.176	0.154	1cd1A.pdb.gz
12	PDB:2qriA	0.612	0.382	2.328E-9	398	0.130	0.078	2qriA.pdb.gz
13	PDB:3ov6A	0.604	0.396	3.255E-9	376	0.164	0.104	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
14	PDB:3es6A	0.526	0.461	6.018E-9	277	0.101	0.087	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
15	PDB:3s6cA	0.621	0.408	6.363E-9	372	0.172	0.110	3s6cA.pdb.gz
16	PDB:6mp0A	0.585	0.376	7.115E-9	388	0.118	0.072	6mp0A.pdb.gz
17	PDB:5j6hA	0.599	0.525	9.948E-9	275	0.105	0.091	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
18	PDB:6d7gA	0.584	0.375	1.739E-8	386	0.105	0.065	6d7gA.pdb.gz
19	PDB:6fgbA	0.554	0.505	2.571E-8	265	0.139	0.125	6fgbA.pdb.gz
20	PDB:3nwmA	0.594	0.383	4.020E-8	384	0.118	0.073	3nwmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UNN8	7.12e-178	489	238	1.000	1.000	EPCR_HUMAN Endothelial protein C receptor OS=Homo sapiens OX=9606 GN=PROCR PE=1 SV=1
2	Q4V8I1	4.70e-110	318	241	0.651	0.643	EPCR_RAT Endothelial protein C receptor OS=Rattus norvegicus OX=10116 GN=Procr PE=2 SV=1
3	Q64695	4.32e-98	288	242	0.622	0.612	EPCR_MOUSE Endothelial protein C receptor OS=Mus musculus OX=10090 GN=Procr PE=1 SV=3
4	A0A669KB34	8.26e-10	59.3	242	0.244	0.240	A0A669KB34_HUMAN CD1d molecule OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
5	P15813	5.63e-08	54.7	335	0.218	0.155	CD1D_HUMAN Antigen-presenting glycoprotein CD1d OS=Homo sapiens OX=9606 GN=CD1D PE=1 SV=1
6	P14428	1.94e-04	43.9	328	0.126	0.091	HA1Q_MOUSE H-2 class I histocompatibility antigen, K-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
7	P03991	2.64e-04	43.9	368	0.126	0.082	HA1W_MOUSE H-2 class I histocompatibility antigen, K-W28 alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=2
8	P13599	0.001	42.0	366	0.134	0.087	FCGRN_RAT IgG receptor FcRn large subunit p51 OS=Rattus norvegicus OX=10116 GN=Fcgrt PE=1 SV=1
9	Q6MGB8	0.001	41.6	366	0.155	0.101	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
10	Q9TNU7	0.001	38.9	91	0.097	0.253	Q9TNU7_HUMAN HLA-E protein (Fragment) OS=Homo sapiens OX=9606 GN=HLA-E PE=3 SV=1
11	P13747	0.002	41.2	358	0.101	0.067	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
12	P01901	0.003	40.8	369	0.118	0.076	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
13	P11609	0.003	40.8	336	0.227	0.161	CD1D1_MOUSE Antigen-presenting glycoprotein CD1d1 OS=Mus musculus OX=10090 GN=Cd1d1 PE=1 SV=3
14	P10321	0.006	39.7	366	0.101	0.066	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
15	P01895	0.007	39.3	298	0.105	0.084	HA1Y_MOUSE H-2 class I histocompatibility antigen, alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
16	P01900	0.011	38.9	365	0.105	0.068	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
17	A0A0G2K4S5	0.029	37.4	356	0.151	0.101	A0A0G2K4S5_RAT RT1 class Ia, locus A2 OS=Rattus norvegicus OX=10116 GN=RT1-CE1 PE=3 SV=2
18	P14426	0.033	37.4	362	0.113	0.075	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
19	Q8HWE5	0.041	37.0	355	0.134	0.090	MILL2_MOUSE MHC class I-like protein MILL2 OS=Mus musculus OX=10090 GN=Mill2 PE=1 SV=1
20	A0A8J8XB15	0.042	37.0	342	0.118	0.082	A0A8J8XB15_RAT RT1 class I, locus CE14 OS=Rattus norvegicus OX=10116 GN=RT1-CE14 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14415 DUF4424	4.6e+02	11.4	Domain of unknown function (DUF4424)
2	PF00129 MHC_I	0.00023	32.3	Class I Histocompatibility antigen, domains alpha 1 and 2
3	PF16497 MHC_I_3	3e-11	54.7	MHC-I family domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000234071	0.998	Vitamin K-dependent protein C
2	9606.ENSP00000366307	0.998	Thrombomodulin
3	9606.ENSP00000339191	0.990	Caveolin-1
4	9606.ENSP00000234347	0.988	Myeloblastin
5	9606.ENSP00000308541	0.981	Prothrombin
6	9606.ENSP00000219400	0.979	COX assembly mitochondrial protein 2 homolog
7	9606.ENSP00000321326	0.977	Proteinase-activated receptor 1
8	9606.ENSP00000364731	0.976	Coagulation factor VII
9	9606.ENSP00000355944	0.969	Kinetochore-associated protein NSL1 homolog
10	9606.ENSP00000264832	0.940	Intercellular adhesion molecule 1
11	9606.ENSP00000296029	0.932	Platelet factor 4
12	9606.ENSP00000226524	0.904	Platelet factor 4 variant
13	9606.ENSP00000364709	0.862	Coagulation factor X
14	9606.ENSP00000377783	0.860	Vitamin K-dependent protein S
15	9606.ENSP00000334145	0.814	Tissue factor
16	9606.ENSP00000233156	0.776	Tissue factor pathway inhibitor
17	9606.ENSP00000356211	0.731	Transmembrane protein 183A
18	9606.ENSP00000356671	0.681	Antithrombin-III
19	9606.ENSP00000305416	0.671	Sphingosine 1-phosphate receptor 1
20	9606.ENSP00000292401	0.669	Zinc-alpha-2-glycoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.998	signaling receptor activity
GO:0005102	0.664	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050819	0.994	negative regulation of coagulation
GO:0050794	0.614	regulation of cellular process
GO:0009987	0.375	cellular process
GO:0048583	0.367	regulation of response to stimulus
GO:0048518	0.345	positive regulation of biological process
GO:0050896	0.328	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005576	0.990	extracellular region
GO:0043229	0.984	intracellular organelle
GO:0005615	0.982	extracellular space
GO:0005886	0.975	plasma membrane
GO:0043227	0.973	membrane-bounded organelle
GO:0005737	0.939	cytoplasm
GO:0065010	0.931	extracellular membrane-bounded organelle
GO:0012505	0.924	endomembrane system
GO:1903561	0.923	extracellular vesicle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0070062	0.914	extracellular exosome
GO:0009986	0.759	cell surface
GO:0070013	0.602	intracellular organelle lumen
GO:0070161	0.526	anchoring junction
GO:0030055	0.520	cell-substrate junction
GO:0005925	0.511	focal adhesion
GO:0031981	0.407	nuclear lumen
GO:0097708	0.386	intracellular vesicle
GO:0005783	0.373	endoplasmic reticulum
GO:0005654	0.370	nucleoplasm
GO:0043232	0.333	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]