StarFunc result for job id Q9UNP4

User Input

>input (418 residues)
MRTKAAGCAERRPLQPRTEAAAAPAGRAMPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRP
SLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKEC
RPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPE
HDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTI
RMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIP
LQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAG
FGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNP4	1.000	1.000	2.051E-86	418	1.000	1.000	Q9UNP4.pdb.gz	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
2	AFDB:A0JMC3	0.769	0.879	2.838E-41	364	0.376	0.431	A0JMC3.pdb.gz	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
3	AFDB:Q6EV30	0.713	0.775	4.271E-35	383	0.323	0.352	Q6EV30.pdb.gz
4	AFDB:Q11203	0.659	0.733	6.822E-34	375	0.306	0.341	Q11203.pdb.gz	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
5	AFDB:P61131	0.635	0.791	1.787E-27	333	0.266	0.333	P61131.pdb.gz	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
6	AFDB:Q9Y274	0.615	0.768	2.586E-27	331	0.242	0.305	Q9Y274.pdb.gz	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
7	AFDB:Q02745	0.556	0.667	5.630E-21	343	0.189	0.230	Q02745.pdb.gz	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
8	AFDB:Q50J65	0.505	0.552	9.214E-21	381	0.218	0.239	Q50J65.pdb.gz
9	AFDB:Q11201	0.564	0.683	1.814E-20	340	0.194	0.238	Q11201.pdb.gz	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
10	AFDB:P54751	0.557	0.680	1.270E-18	337	0.187	0.231	P54751.pdb.gz	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
11	PDB:6aplC	0.564	0.750	4.650E-15	306	0.153	0.209	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:3fpjB	0.086	0.113	2.023E-1	265	0.077	0.121	3fpjB.pdb.gz	Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
13	PDB:4qnxB	0.098	0.113	2.023E-1	322	0.065	0.084	4qnxB.pdb.gz
14	PDB:4gq0A	0.137	0.162	2.289E-1	318	0.069	0.091	4gq0A.pdb.gz	Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
15	PDB:1o8cA	0.116	0.140	2.434E-1	324	0.041	0.052	1o8cA.pdb.gz	Structure of Escherichia Coli Yhdh, a Putative Quinone Oxidoreductase
16	PDB:2cd9A	0.149	0.164	2.434E-1	363	0.062	0.072	2cd9A.pdb.gz	The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
17	PDB:1mjfA	0.087	0.113	2.589E-1	271	0.041	0.063	1mjfA.pdb.gz
18	PDB:3m6iA	0.127	0.144	2.589E-1	358	0.038	0.045	3m6iA.pdb.gz	Structure and engineering of L-arabinitol 4-dehydrogenase from Neurospora crassa
19	PDB:6opcF	0.105	0.075	2.589E-1	681	0.065	0.040	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
20	PDB:1wdlA	0.151	0.102	2.753E-1	715	0.050	0.029	1wdlA.pdb.gz	Structural basis for channelling mechanism of a fatty acid beta-oxidation multienzyme complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UNP4	0.0	875	418	1.000	1.000	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
2	F1RCA6	2.43e-93	287	364	0.368	0.423	F1RCA6_DANRE Lactosylceramide alpha-2,3-sialyltransferase isoform X1 OS=Danio rerio OX=7955 GN=st3Gal-V PE=3 SV=1
3	A0JMC3	1.00e-92	285	364	0.366	0.420	A0JMC3_DANRE Lactosylceramide alpha-2,3-sialyltransferase OS=Danio rerio OX=7955 GN=st3Gal-V PE=2 SV=1
4	Q08BF4	7.61e-79	250	382	0.287	0.314	Q08BF4_DANRE ST3 beta-galactoside alpha-2,3-sialyltransferase 5, like OS=Danio rerio OX=7955 GN=zgc:153853 PE=2 SV=1
5	P97325	4.51e-74	238	374	0.301	0.337	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
6	Q11203	4.56e-73	235	375	0.297	0.331	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
7	Q02734	6.88e-73	234	374	0.299	0.334	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
8	Q91Y74	1.67e-49	172	333	0.239	0.300	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
9	P61131	1.35e-48	170	333	0.237	0.297	SIA4C_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St3gal4 PE=1 SV=1
10	Q9Y274	3.04e-48	169	331	0.244	0.308	SIA10_HUMAN Type 2 lactosamine alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL6 PE=1 SV=1
11	Q11206	4.66e-47	166	333	0.227	0.285	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
12	Q16842	4.53e-22	98.6	350	0.208	0.249	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
13	Q11205	9.44e-22	97.8	350	0.206	0.246	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
14	Q11204	1.72e-21	97.1	350	0.206	0.246	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
15	Q11201	1.12e-19	91.7	340	0.134	0.165	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
16	P54751	9.18e-19	89.0	337	0.170	0.211	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
17	Q02745	3.25e-18	87.4	343	0.132	0.160	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
18	B0CN48	8.64e-16	80.5	374	0.167	0.187	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
19	O43173	8.24e-14	74.7	380	0.146	0.161	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
20	Q64689	8.63e-14	74.7	380	0.146	0.161	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	2.9e-68	241.9	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379353	0.987	Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
2	9606.ENSP00000341562	0.977	Beta-1,4 N-acetylgalactosaminyltransferase 1
3	9606.ENSP00000306459	0.971	Beta-1,4-galactosyltransferase 6
4	9606.ENSP00000376456	0.937	Beta-1,3-galactosyltransferase 1
5	9606.ENSP00000169298	0.926	Beta-galactoside alpha-2,6-sialyltransferase 1
6	9606.ENSP00000381699	0.925	Beta-1,3-galactosyltransferase 5
7	9606.ENSP00000268097	0.921	Beta-hexosaminidase subunit alpha
8	9606.ENSP00000311648	0.919	2-hydroxyacylsphingosine 1-beta-galactosyltransferase
9	9606.ENSP00000261416	0.906	Beta-hexosaminidase subunit beta
10	9606.ENSP00000306920	0.887	Beta-galactosidase
11	9606.ENSP00000026218	0.723	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
12	9606.ENSP00000363397	0.671	Ceramide glucosyltransferase
13	9606.ENSP00000390784	0.632	Beta-1,3-galactosyltransferase 4
14	9606.ENSP00000265000	0.626	N-acetylgalactosaminyltransferase 7
15	9606.ENSP00000261483	0.620	Alpha-mannosidase 2
16	9606.ENSP00000277540	0.556	Diphthine methyltransferase
17	9606.ENSP00000360776	0.556	Beta-1,4-galactosyltransferase 5
18	9606.ENSP00000301391	0.553	Neuferricin
19	9606.ENSP00000294064	0.547	Sialidase-3
20	9606.ENSP00000416002	0.546	UDP-galactose translocator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0047291	0.741	lactosylceramide alpha-2,3-sialyltransferase activity
GO:0005515	0.679	protein binding
GO:0003836	0.642	beta-galactoside (CMP) alpha-2,3-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0044249	0.993	cellular biosynthetic process
GO:1901137	0.992	carbohydrate derivative biosynthetic process
GO:1901566	0.992	organonitrogen compound biosynthetic process
GO:0006664	0.967	glycolipid metabolic process
GO:0005975	0.943	carbohydrate metabolic process
GO:0006665	0.936	sphingolipid metabolic process
GO:0006687	0.933	glycosphingolipid metabolic process
GO:0030148	0.901	sphingolipid biosynthetic process
GO:0006688	0.861	glycosphingolipid biosynthetic process
GO:0043170	0.571	macromolecule metabolic process
GO:0019538	0.523	protein metabolic process
GO:0044260	0.512	cellular macromolecule metabolic process
GO:0009059	0.506	macromolecule biosynthetic process
GO:0043412	0.489	macromolecule modification
GO:0036211	0.474	protein modification process
GO:0009100	0.474	glycoprotein metabolic process
GO:0034645	0.440	cellular macromolecule biosynthetic process
GO:0009101	0.303	glycoprotein biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0071944	0.959	cell periphery
GO:0005886	0.946	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:18417	0.741	a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + CMP-N-acetyl-beta-neuraminate = CMP + ganglioside GM3 (d18:1(4E)) + H(+)
EC:2.4.99.9	0.741	Transferred entry: 2.4.3.9.
RHEA:21616	0.642	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.4	0.642	Transferred entry: 2.4.3.4.

[back to server]