StarFunc result for job id Q9UNQ0

User Input

>input (655 residues)
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1LUE4	0.968	0.968	5.339E-99	655	1.000	1.000	A1LUE4.pdb.gz
2	AFDB:Q7TMS5	0.918	0.915	3.504E-86	657	0.820	0.817	Q7TMS5.pdb.gz	ABCG2_MOUSE Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Mus musculus OX=10090 GN=Abcg2 PE=1 SV=1
3	PDB:6hbuA	0.872	0.977	7.025E-81	584	0.887	0.995	6hbuA.pdb.gz	Cryo-EM structures of a human ABCG2 mutant trapped in ATP-bound and substrate-bound states.
4	AFDB:A8IJF9	0.881	0.881	4.322E-73	655	0.605	0.605	A8IJF9.pdb.gz	A8IJF9_ONCMY Breast cancer resistance protein OS=Oncorhynchus mykiss OX=8022 GN=ABCG2 PE=2 SV=1
5	AFDB:A0A0R4IUY7	0.818	0.832	2.470E-69	643	0.611	0.622	A0A0R4IUY7.pdb.gz
6	AFDB:Q38AM7	0.825	0.836	3.515E-48	646	0.319	0.324	Q38AM7.pdb.gz	Q38AM7_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3320 PE=4 SV=1
7	AFDB:P25371	0.805	0.517	3.810E-46	1049	0.316	0.197	P25371.pdb.gz	ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADP1 PE=1 SV=2
8	AFDB:Q9C6W5	0.797	0.806	1.611E-45	648	0.304	0.307	Q9C6W5.pdb.gz	AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1
9	AFDB:Q54T02	0.788	0.453	4.341E-45	1159	0.354	0.200	Q54T02.pdb.gz	ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum OX=44689 GN=abcG24 PE=3 SV=1
10	AFDB:P10090	0.791	0.756	8.158E-45	687	0.296	0.282	P10090.pdb.gz	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2
11	AFDB:Q9M3D6	0.766	0.697	2.000E-43	725	0.287	0.259	Q9M3D6.pdb.gz	AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana OX=3702 GN=ABCG19 PE=1 SV=1
12	PDB:7jr7B	0.727	0.815	1.109E-33	579	0.260	0.294	7jr7B.pdb.gz
13	PDB:7p04A	0.789	0.395	3.898E-32	1353	0.252	0.122	7p04A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
14	PDB:8cubC	0.740	0.818	1.724E-31	588	0.234	0.260	8cubC.pdb.gz	Structural Analysis of Cholesterol Binding and Sterol Selectivity by ABCG5/G8.
15	PDB:7r8eA	0.750	0.890	5.820E-31	548	0.253	0.303	7r8eA.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
16	PDB:7r89B	0.694	0.846	3.862E-30	529	0.243	0.301	7r89B.pdb.gz	Molecular basis of cholesterol efflux via ABCG subfamily transporters.
17	PDB:7p03A	0.775	0.395	9.948E-30	1333	0.249	0.122	7p03A.pdb.gz
18	PDB:5do7B	0.697	0.803	4.207E-29	562	0.247	0.288	5do7B.pdb.gz
19	PDB:7p06A	0.792	0.395	2.130E-28	1350	0.258	0.125	7p06A.pdb.gz	Structure and efflux mechanism of the yeast pleiotropic drug resistance transporter Pdr5.
20	PDB:6mbnA	0.315	0.804	7.013E-13	241	0.078	0.212	6mbnA.pdb.gz	Combining Mutations That Inhibit Two Distinct Steps of the ATP Hydrolysis Cycle Restores Wild-Type Function in the Lipopolysaccharide Transporter and Shows that ATP Binding Triggers Transport.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8IJF9	0.0	823	655	0.608	0.608	A8IJF9_ONCMY Breast cancer resistance protein OS=Oncorhynchus mykiss OX=8022 GN=ABCG2 PE=2 SV=1
2	Q2Q447	0.0	832	643	0.600	0.611	Q2Q447_DANRE ATP-binding cassette sub-family G member 2 OS=Danio rerio OX=7955 GN=wu:fd59c01 PE=1 SV=1
3	Q7TMS5	0.0	1112	657	0.820	0.817	ABCG2_MOUSE Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Mus musculus OX=10090 GN=Abcg2 PE=1 SV=1
4	Q80W57	0.0	1111	657	0.815	0.813	ABCG2_RAT Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Rattus norvegicus OX=10116 GN=Abcg2 PE=1 SV=1
5	Q9UNQ0	0.0	1350	655	1.000	1.000	ABCG2_HUMAN Broad substrate specificity ATP-binding cassette transporter ABCG2 OS=Homo sapiens OX=9606 GN=ABCG2 PE=1 SV=3
6	Q38AM7	6.84e-100	321	646	0.328	0.333	Q38AM7_TRYB2 ATP-binding cassette protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3320 PE=4 SV=1
7	P10090	2.06e-94	307	687	0.305	0.291	WHITE_DROME Protein white OS=Drosophila melanogaster OX=7227 GN=w PE=1 SV=2
8	Q93YS4	2.58e-94	309	751	0.315	0.274	AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana OX=3702 GN=ABCG22 PE=1 SV=1
9	Q55DA0	9.27e-94	304	615	0.302	0.322	ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum OX=44689 GN=abcG22 PE=2 SV=1
10	Q9C6W5	7.74e-91	297	648	0.316	0.319	AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana OX=3702 GN=ABCG14 PE=1 SV=1
11	Q9C8K2	1.15e-84	281	687	0.308	0.294	AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana OX=3702 GN=ABCG12 PE=1 SV=1
12	Q8RXN0	6.93e-84	280	703	0.281	0.262	AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana OX=3702 GN=ABCG11 PE=1 SV=1
13	Q9M3D6	6.56e-83	278	725	0.295	0.266	AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana OX=3702 GN=ABCG19 PE=1 SV=1
14	Q6X4V5	1.99e-81	273	705	0.307	0.285	Q6X4V5_GOSHI ABC transporter OS=Gossypium hirsutum OX=3635 GN=WBC1 PE=2 SV=1
15	Q9SZR9	2.56e-81	271	638	0.319	0.328	AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana OX=3702 GN=ABCG9 PE=1 SV=2
16	P25371	9.76e-80	275	1049	0.301	0.188	ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADP1 PE=1 SV=2
17	Q84TH5	1.64e-79	267	662	0.299	0.296	AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana OX=3702 GN=ABCG25 PE=1 SV=1
18	Q9NGP5	1.92e-79	277	1328	0.263	0.130	ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum OX=44689 GN=abcG2 PE=1 SV=2
19	Q9LK50	4.10e-79	267	685	0.252	0.241	AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana OX=3702 GN=ABCG26 PE=2 SV=2
20	Q9C8J8	1.41e-77	263	678	0.282	0.273	AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana OX=3702 GN=ABCG13 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13304 AAA_21	0.05	25.0	AAA domain, putative AbiEii toxin, Type IV TA system
2	PF13476 AAA_23	3.3	19.7	AAA domain
3	PF13555 AAA_29	1.7e+02	13.4	P-loop containing region of AAA domain
4	PF01061 ABC2_membrane	3.2e-37	139.5	ABC-2 type transporter
5	PF12698 ABC2_membrane_3	0.018	25.8	ABC-2 family transporter protein
6	PF19055 ABC2_membrane_7	9.1e-12	56.2	ABC-2 type transporter
7	PF00005 ABC_tran	2e-19	81.9	ABC transporter
8	PF03193 RsgA_GTPase	1.2e+02	14.0	RsgA GTPase
9	PF13558 SbcC_Walker_B	1.2e+02	14.3	SbcC/RAD50-like, Walker B motif
10	PF02463 SMC_N	0.17	22.9	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237612

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382342	0.932	Multidrug resistance-associated protein 1
2	9606.ENSP00000359478	0.903	Canalicular multispecific organic anion transporter 1
3	9606.ENSP00000473391	0.880	annotation not available
4	9606.ENSP00000365851	0.855	Polycomb complex protein BMI-1
5	9606.ENSP00000245539	0.840	Mitochondrial ribosomal protein S7
6	9606.ENSP00000256958	0.838	Solute carrier organic anion transporter family member 1B1
7	9606.ENSP00000441269	0.838	Solute carrier organic anion transporter family member
8	9606.ENSP00000337915	0.834	Cytochrome P450 3A4
9	9606.ENSP00000426809	0.831	Prominin-1
10	9606.ENSP00000264784	0.814	Solute carrier family 2, facilitated glucose transporter member 9
11	9606.ENSP00000261196	0.813	Solute carrier organic anion transporter family member 1B3
12	9606.ENSP00000289575	0.807	Solute carrier organic anion transporter family member 2B1
13	9606.ENSP00000366797	0.805	Solute carrier family 22 member 12
14	9606.ENSP00000398632	0.794	CD44 antigen
15	9606.ENSP00000337335	0.783	Solute carrier family 22 member 8
16	9606.ENSP00000257118	0.777	Polyhomeotic-like protein 2
17	9606.ENSP00000301891	0.760	Solute carrier family 22 member 11
18	9606.ENSP00000275493	0.746	Epidermal growth factor receptor
19	9606.ENSP00000295897	0.741	Serum albumin
20	9606.ENSP00000305974	0.741	Solute carrier organic anion transporter family member 1A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.999	ATP-dependent activity
GO:0090482	0.999	vitamin transmembrane transporter activity
GO:0022804	0.999	active transmembrane transporter activity
GO:0015562	0.999	efflux transmembrane transporter activity
GO:0008514	0.999	organic anion transmembrane transporter activity
GO:0005515	0.997	protein binding
GO:1901702	0.996	salt transmembrane transporter activity
GO:0042910	0.993	xenobiotic transmembrane transporter activity
GO:0042626	0.993	ATPase-coupled transmembrane transporter activity
GO:0042887	0.992	amide transmembrane transporter activity
GO:0032217	0.990	riboflavin transmembrane transporter activity
GO:1901682	0.850	sulfur compound transmembrane transporter activity
GO:0046983	0.660	protein dimerization activity
GO:0005342	0.613	organic acid transmembrane transporter activity
GO:0005319	0.578	lipid transporter activity
GO:0046943	0.560	carboxylic acid transmembrane transporter activity
GO:0042802	0.504	identical protein binding
GO:0003824	0.480	catalytic activity
GO:0140359	0.475	ABC-type transporter activity
GO:0097159	0.350	organic cyclic compound binding
GO:1901363	0.349	heterocyclic compound binding
GO:0008028	0.302	monocarboxylic acid transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.976	transport
GO:0009987	0.971	cellular process
GO:0050896	0.901	response to stimulus
GO:0071702	0.899	organic substance transport
GO:0015711	0.830	organic anion transport
GO:0008152	0.645	metabolic process
GO:0071705	0.618	nitrogen compound transport
GO:0065007	0.604	biological regulation
GO:0071704	0.546	organic substance metabolic process
GO:0042221	0.527	response to chemical
GO:0051716	0.502	cellular response to stimulus
GO:0050789	0.486	regulation of biological process
GO:0044237	0.449	cellular metabolic process
GO:0050794	0.426	regulation of cellular process
GO:0032501	0.406	multicellular organismal process
GO:0006807	0.400	nitrogen compound metabolic process
GO:0070887	0.319	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0031981	0.986	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0005737	0.717	cytoplasm
GO:0098590	0.595	plasma membrane region
GO:0016324	0.380	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.993	Translocases.
RHEA:35015	0.990	riboflavin(in) = riboflavin(out)

[back to server]