StarFunc result for job id Q9UNQ2

User Input

>input (313 residues)
MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVV
LEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLP
FFDTCVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQ
LLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSA
AFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIR
LLHGFNAEGIHFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNQ2	1.000	1.000	7.472E-67	313	1.000	1.000	Q9UNQ2.pdb.gz	DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
2	PDB:7mqaNL	0.843	0.945	8.094E-54	278	0.888	1.000	7mqaNL.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:Q9USU2	0.915	0.932	1.081E-48	307	0.575	0.586	Q9USU2.pdb.gz	DIM1_SCHPO Dimethyladenosine transferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=3 SV=1
4	AFDB:P41819	0.911	0.897	1.171E-47	318	0.581	0.572	P41819.pdb.gz	DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIM1 PE=1 SV=1
5	AFDB:O22268	0.884	0.786	6.865E-45	353	0.553	0.490	O22268.pdb.gz	DIM1A_ARATH Ribosomal RNA small subunit methyltransferase OS=Arabidopsis thaliana OX=3702 GN=DIM1A PE=1 SV=1
6	AFDB:Q585P9	0.884	0.806	3.171E-42	344	0.511	0.465	Q585P9.pdb.gz	Q585P9_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.360 PE=3 SV=1
7	PDB:7ajuJL	0.866	0.956	4.973E-40	283	0.546	0.604	7ajuJL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
8	AFDB:Q9FK02	0.881	0.729	2.018E-35	380	0.425	0.350	Q9FK02.pdb.gz	DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIM1B PE=1 SV=1
9	AFDB:P06992	0.716	0.816	4.243E-22	273	0.240	0.275	P06992.pdb.gz	RSMA_ECOLI Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12) OX=83333 GN=rsmA PE=1 SV=1
10	AFDB:Q8JZM0	0.759	0.692	5.074E-22	345	0.252	0.229	Q8JZM0.pdb.gz	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
11	PDB:3tpzB	0.690	0.801	8.105E-22	267	0.246	0.288	3tpzB.pdb.gz
12	AFDB:O65090	0.735	0.674	1.482E-21	343	0.268	0.245	O65090.pdb.gz	DIM1C_ARATH Ribosomal RNA small subunit methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PFC1 PE=2 SV=1
13	AFDB:Q8WVM0	0.743	0.675	3.413E-21	346	0.249	0.225	Q8WVM0.pdb.gz	TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1
14	PDB:6ajkA	0.717	0.764	4.296E-21	293	0.240	0.256	6ajkA.pdb.gz	Structural insights into dimethylation of 12S rRNA by TFB1M: indispensable role in translation of mitochondrial genes and mitochondrial function.
15	PDB:4gc5A	0.742	0.728	3.256E-20	319	0.259	0.254	4gc5A.pdb.gz
16	PDB:6ymwB	0.653	0.605	1.733E-13	340	0.192	0.176	6ymwB.pdb.gz	Cryo-EM Structures Reveal Transcription Initiation Steps by Yeast Mitochondrial RNA Polymerase.
17	PDB:6erpF	0.580	0.625	7.105E-11	288	0.185	0.201	6erpF.pdb.gz	Structural Basis of Mitochondrial Transcription Initiation.
18	PDB:2bh2A	0.378	0.290	2.038E-8	418	0.105	0.079	2bh2A.pdb.gz	A Unique RNA Fold in the Ruma-RNA-Cofactor Ternary Complex Contributes to Substrate Selectivity and Enzymatic Function
19	PDB:3lccA	0.371	0.508	3.924E-8	216	0.080	0.116	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana
20	PDB:6q56A	0.388	0.501	4.165E-8	234	0.109	0.145	6q56A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGB1	0.0	542	275	0.843	0.960	A0A0C4DGB1_HUMAN rRNA adenine N(6)-methyltransferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
2	Q9UNQ2	0.0	640	313	1.000	1.000	DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1
3	Q9USU2	1.22e-134	386	307	0.569	0.580	DIM1_SCHPO Dimethyladenosine transferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=3 SV=1
4	P41819	9.18e-129	371	318	0.553	0.544	DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIM1 PE=1 SV=1
5	O22268	6.54e-119	348	353	0.543	0.482	DIM1A_ARATH Ribosomal RNA small subunit methyltransferase OS=Arabidopsis thaliana OX=3702 GN=DIM1A PE=1 SV=1
6	Q585P9	4.64e-112	330	344	0.511	0.465	Q585P9_TRYB2 rRNA adenine N(6)-methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.360 PE=3 SV=1
7	Q9FK02	2.14e-77	243	380	0.444	0.366	DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DIM1B PE=1 SV=1
8	P06992	6.69e-20	89.4	273	0.217	0.249	RSMA_ECOLI Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12) OX=83333 GN=rsmA PE=1 SV=1
9	O65090	6.63e-18	85.1	343	0.265	0.242	DIM1C_ARATH Ribosomal RNA small subunit methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PFC1 PE=2 SV=1
10	Q8JZM0	5.48e-17	82.4	345	0.217	0.197	TFB1M_MOUSE Dimethyladenosine transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Tfb1m PE=1 SV=1
11	Q54M56	4.29e-16	80.9	485	0.217	0.140	Q54M56_DICDI rRNA adenine N(6)-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286199 PE=3 SV=1
12	Q9VTM5	2.78e-14	74.3	330	0.214	0.203	TFB1M_DROME Dimethyladenosine transferase 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtTFB1 PE=2 SV=2
13	Q8WVM0	5.82e-14	73.6	346	0.192	0.173	TFB1M_HUMAN Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1
14	Q10838	5.31e-09	57.0	179	0.153	0.268	Q10838_MYCTU Probable 23S rRNA methyltransferase Erm(37) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=erm(37) PE=3 SV=1
15	Q9H5Q4	0.007	40.0	396	0.080	0.063	TFB2M_HUMAN Dimethyladenosine transferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TFB2M PE=1 SV=1
16	Q9XBC9	0.009	39.3	259	0.089	0.108	Q9XBC9_AMYOR Putative rRNA methylase OS=Amycolatopsis orientalis OX=31958 GN=CZA382.22c PE=4 SV=1
17	Q84BQ9	0.062	37.0	254	0.105	0.130	PRMA_THET8 Ribosomal protein L11 methyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=prmA PE=1 SV=2
18	A4F7P5	0.071	37.0	306	0.086	0.088	ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=eryG PE=1 SV=1
19	Q5W266	0.12	36.2	348	0.073	0.066	PIGF_SERS3 S-adenosyl-L-methionine-dependent methyl transferase PigF OS=Serratia sp. (strain ATCC 39006) OX=104623 GN=pigF PE=1 SV=1
20	P26236	0.18	35.4	224	0.073	0.103	BCHM_RHOCA Magnesium-protoporphyrin O-methyltransferase OS=Rhodobacter capsulatus OX=1061 GN=bchM PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02353 CMAS	1.3e+02	13.3	Mycolic acid cyclopropane synthetase
2	PF14490 HHH_4	5.3e+02	12.0	Helix-hairpin-helix containing domain
3	PF08241 Methyltransf_11	0.072	25.1	Methyltransferase domain
4	PF08242 Methyltransf_12	10	18.3	Methyltransferase domain
5	PF12847 Methyltransf_18	4.1e+02	12.4	Methyltransferase domain
6	PF00891 Methyltransf_2	1.7e+02	12.9	O-methyltransferase domain
7	PF13489 Methyltransf_23	9.2	17.5	Methyltransferase domain
8	PF13649 Methyltransf_25	0.00036	32.5	Methyltransferase domain
9	PF02475 Met_10	7.1	17.9	Met-10+ like-protein
10	PF05175 MTS	31	15.6	Methyltransferase small domain
11	PF01135 PCMT	4.9	18.4	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
12	PF00398 RrnaAD	1.4e-62	222.7	Ribosomal RNA adenine dimethylase
13	PF01209 Ubie_methyltran	1.6e+02	13.1	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000199320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230340	0.993	Bystin
2	9606.ENSP00000283109	0.993	Serine/threonine-protein kinase RIO2
3	9606.ENSP00000301364	0.990	Pre-rRNA-processing protein TSR1 homolog
4	9606.ENSP00000263657	0.988	RNA-binding protein PNO1
5	9606.ENSP00000232888	0.967	U3 small nucleolar RNA-interacting protein 2
6	9606.ENSP00000328854	0.966	Nucleolar complex protein 4 homolog
7	9606.ENSP00000259239	0.963	U3 small nucleolar ribonucleoprotein protein IMP4
8	9606.ENSP00000358812	0.962	Protein RRP5 homolog
9	9606.ENSP00000296792	0.960	U3 small nucleolar RNA-associated protein 15 homolog
10	9606.ENSP00000308179	0.959	WD repeat-containing protein 3
11	9606.ENSP00000314193	0.952	WD repeat-containing protein 75
12	9606.ENSP00000221801	0.950	rRNA 2'-O-methyltransferase fibrillarin
13	9606.ENSP00000311135	0.950	Probable ATP-dependent RNA helicase DHX37
14	9606.ENSP00000327179	0.950	U3 small nucleolar RNA-associated protein 4 homolog
15	9606.ENSP00000363642	0.947	Ribosome biogenesis protein BMS1 homolog
16	9606.ENSP00000470560	0.946	Ribosomal RNA small subunit methyltransferase NEP1
17	9606.ENSP00000355541	0.945	HEAT repeat-containing protein 1
18	9606.ENSP00000370589	0.942	Nucleolar protein 56
19	9606.ENSP00000264279	0.941	Nucleolar protein 58
20	9606.ENSP00000326981	0.940	U3 small nucleolar ribonucleoprotein protein IMP3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008170	1.000	N-methyltransferase activity
GO:0003723	1.000	RNA binding
GO:0016433	0.996	rRNA (adenine) methyltransferase activity
GO:0000179	0.962	rRNA (adenine-N6,N6-)-dimethyltransferase activity
GO:0005515	0.777	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0022613	0.993	ribonucleoprotein complex biogenesis
GO:0010467	0.989	gene expression
GO:0034641	0.986	cellular nitrogen compound metabolic process
GO:0048518	0.981	positive regulation of biological process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0050794	0.974	regulation of cellular process
GO:0090304	0.974	nucleic acid metabolic process
GO:0044260	0.965	cellular macromolecule metabolic process
GO:0042254	0.963	ribosome biogenesis
GO:0048522	0.957	positive regulation of cellular process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:0009451	0.955	RNA modification
GO:0006364	0.950	rRNA processing
GO:0009893	0.948	positive regulation of metabolic process
GO:0001510	0.937	RNA methylation
GO:0010604	0.934	positive regulation of macromolecule metabolic process
GO:0000154	0.916	rRNA modification
GO:0051173	0.781	positive regulation of nitrogen compound metabolic process
GO:0031167	0.751	rRNA methylation
GO:0010468	0.742	regulation of gene expression
GO:0031325	0.639	positive regulation of cellular metabolic process
GO:0051252	0.626	regulation of RNA metabolic process
GO:0045935	0.482	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.329	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005730	0.998	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]