StarFunc result for job id Q9UNS1

User Input

>input (1208 residues)
MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQI
LQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAY
KEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKID
DDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQG
RLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKG
LHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGS
VKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYE
MMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRE
LFLALFRKFDERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVVQNKQKKRRKKKKKVL
DQAIVSGNVPSSPEEVEAVWPALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAM
VRIQDCLLAGQAPQALTLLRSAREVWPEGDVFGSQDISPEEEIQLLKQILSAPLPRQQGP
EERGAEEEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAH
TNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFAL
AAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLANKDV
EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRL
FEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGA
ESLKDFCQEDLEEEENLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLL
WLQNCLIRAADDREEDGCSQAVPLVPLTEENEEAMENEQFQQLLRKLGVRPPASGQETFW
RIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLA
HKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY
QIEDDEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNS1	1.000	1.000	0.000	1208	1.000	1.000	Q9UNS1.pdb.gz	TIM_HUMAN Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS PE=1 SV=2
2	AFDB:Q9Z2Y1	0.734	0.736	0.000	1205	0.820	0.822	Q9Z2Y1.pdb.gz	TIM_RAT Protein timeless homolog OS=Rattus norvegicus OX=10116 GN=Timeless PE=1 SV=1
3	AFDB:Q8INH7	0.556	0.491	9.958E-69	1384	0.339	0.296	Q8INH7.pdb.gz	Q8INH7_DROME Timeout OS=Drosophila melanogaster OX=7227 GN=timeout PE=1 SV=2
4	PDB:7ploK	0.518	0.970	1.061E-66	639	0.528	0.998	7ploK.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
5	AFDB:G5EDN3	0.519	0.465	2.652E-48	1353	0.267	0.238	G5EDN3.pdb.gz	TIM_CAEEL Protein timeless homolog OS=Caenorhabditis elegans OX=6239 GN=tim-1 PE=1 SV=1
6	PDB:7pmkX	0.444	0.781	7.967E-17	665	0.118	0.214	7pmkX.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
7	AFDB:Q9VFS5	0.107	0.125	7.163E-5	980	0.094	0.115	Q9VFS5.pdb.gz	PP4R3_DROME Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Drosophila melanogaster OX=7227 GN=flfl PE=1 SV=4
8	AFDB:Q54I18	0.070	0.078	1.399E-4	1046	0.091	0.105	Q54I18.pdb.gz	SMEK_DICDI Suppressor of Mek1 OS=Dictyostelium discoideum OX=44689 GN=smkA PE=1 SV=1
9	PDB:4c0qA	0.108	0.134	1.889E-4	871	0.103	0.142	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
10	PDB:3w3uA	0.111	0.116	1.067E-3	1030	0.099	0.116	3w3uA.pdb.gz
11	PDB:6ahoA	0.115	0.137	1.110E-3	916	0.084	0.111	6ahoA.pdb.gz
12	PDB:6gx9A	0.079	0.099	1.201E-3	912	0.102	0.135	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
13	PDB:7ay1A	0.087	0.096	1.249E-3	1033	0.098	0.114	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
14	PDB:7sukSP	0.076	0.049	1.299E-3	2234	0.101	0.055	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:7mq8LM	0.082	0.054	1.351E-3	2005	0.107	0.064	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:5hb4B	0.140	0.127	1.405E-3	1388	0.082	0.071	5hb4B.pdb.gz
17	AFDB:Q6QI06	0.117	0.093	1.605E-3	1708	0.121	0.085	Q6QI06.pdb.gz	RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus OX=10090 GN=Rictor PE=1 SV=2
18	AFDB:Q54WN0	0.071	0.073	6.117E-3	1143	0.106	0.112	Q54WN0.pdb.gz	AP3D_DICDI AP-3 complex subunit delta OS=Dictyostelium discoideum OX=44689 GN=ap3d1 PE=3 SV=1
19	AFDB:Q23925	0.067	0.080	2.624E-2	909	0.075	0.100	Q23925.pdb.gz	YELA_DICDI Yellow mounds protein A OS=Dictyostelium discoideum OX=44689 GN=yelA PE=2 SV=1
20	AFDB:P53804	0.060	0.043	4.925E-2	2025	0.129	0.077	P53804.pdb.gz	TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens OX=9606 GN=TTC3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3LGB9	0.0	1526	1286	0.627	0.589	Q3LGB9_XENLA XTimeless1 OS=Xenopus laevis OX=8355 GN=XTim1 PE=1 SV=1
2	Q8INH7	0.0	618	1384	0.327	0.285	Q8INH7_DROME Timeout OS=Drosophila melanogaster OX=7227 GN=timeout PE=1 SV=2
3	Q9NAX2	0.0	615	1384	0.326	0.285	Q9NAX2_DROME TIM2 protein OS=Drosophila melanogaster OX=7227 GN=timeout PE=2 SV=1
4	Q9NG27	0.0	621	1384	0.328	0.286	Q9NG27_DROME TIMEOUT OS=Drosophila melanogaster OX=7227 GN=timeout PE=2 SV=1
5	Q9R1X4	0.0	1868	1197	0.829	0.837	TIM_MOUSE Protein timeless homolog OS=Mus musculus OX=10090 GN=Timeless PE=1 SV=3
6	Q9UNS1	0.0	2469	1208	1.000	1.000	TIM_HUMAN Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS PE=1 SV=2
7	Q9Z2Y1	0.0	1874	1205	0.817	0.819	TIM_RAT Protein timeless homolog OS=Rattus norvegicus OX=10116 GN=Timeless PE=1 SV=1
8	G5EDN3	7.22e-67	250	1353	0.161	0.144	TIM_CAEEL Protein timeless homolog OS=Caenorhabditis elegans OX=6239 GN=tim-1 PE=1 SV=1
9	P49021	7.02e-22	105	1398	0.057	0.049	TIM_DROME Protein timeless OS=Drosophila melanogaster OX=7227 GN=tim PE=1 SV=3
10	Q9UUM2	5.20e-20	99.0	971	0.122	0.151	SWI1_SCHPO Mating-type switching protein swi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swi1 PE=1 SV=1
11	P53840	1.66e-11	71.6	1238	0.117	0.114	TOF1_YEAST Topoisomerase 1-associated factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOF1 PE=1 SV=1
12	O74386	0.86	35.4	248	0.025	0.121	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
13	Q09725	1.8	35.4	1587	0.024	0.018	MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13565 HTH_32	9.4	18.2	Homeodomain-like domain
2	PF00249 Myb_DNA-binding	4.8e+02	12.4	Myb-like DNA-binding domain
3	PF18082 NAT_N	25	17.2	N-acyltransferase N-terminal domain
4	PF04821 TIMELESS	1.3e-69	246.2	Timeless protein
5	PF05029 TIMELESS_C	4.7e-30	115.0	Timeless PAB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000450607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261881	0.999	TIMELESS-interacting protein
2	9606.ENSP00000478187	0.999	Cryptochrome-2
3	9606.ENSP00000265056	0.998	DNA replication licensing factor MCM2
4	9606.ENSP00000388648	0.998	Serine/threonine-protein kinase Chk1
5	9606.ENSP00000353793	0.996	WD repeat and HMG-box DNA-binding protein 1
6	9606.ENSP00000405726	0.996	Cell division control protein 45 homolog
7	9606.ENSP00000312995	0.995	Claspin
8	9606.ENSP00000307288	0.993	DNA replication licensing factor MCM7
9	9606.ENSP00000480987	0.993	DNA replication licensing factor MCM3
10	9606.ENSP00000314420	0.992	Period circadian protein homolog 1
11	9606.ENSP00000355759	0.991	Poly [ADP-ribose] polymerase 1
12	9606.ENSP00000262105	0.989	DNA replication licensing factor MCM4
13	9606.ENSP00000298139	0.989	Werner syndrome ATP-dependent helicase
14	9606.ENSP00000343741	0.987	Serine/threonine-protein kinase ATR
15	9606.ENSP00000384517	0.984	Aryl hydrocarbon receptor nuclear translocator-like protein 1
16	9606.ENSP00000260810	0.982	DNA topoisomerase 2-binding protein 1
17	9606.ENSP00000308741	0.979	Circadian locomoter output cycles protein kaput
18	9606.ENSP00000347232	0.979	Bloom syndrome protein
19	9606.ENSP00000401018	0.978	GINS complex subunit 3
20	9606.ENSP00000254719	0.977	Replication protein A 70 kDa DNA-binding subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.319	heterocyclic compound binding
GO:0097159	0.319	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.991	cellular process
GO:0050896	0.989	response to stimulus
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0006950	0.981	response to stress
GO:0051716	0.980	cellular response to stimulus
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.972	negative regulation of cellular process
GO:0006974	0.939	cellular response to DNA damage stimulus
GO:0048518	0.931	positive regulation of biological process
GO:0009892	0.912	negative regulation of metabolic process
GO:0009889	0.905	regulation of biosynthetic process
GO:0001763	0.888	morphogenesis of a branching structure
GO:0042752	0.847	regulation of circadian rhythm
GO:0031326	0.820	regulation of cellular biosynthetic process
GO:0010556	0.818	regulation of macromolecule biosynthetic process
GO:0010605	0.799	negative regulation of macromolecule metabolic process
GO:2001141	0.797	regulation of RNA biosynthetic process
GO:0010468	0.793	regulation of gene expression
GO:0051172	0.784	negative regulation of nitrogen compound metabolic process
GO:0031324	0.773	negative regulation of cellular metabolic process
GO:0048522	0.758	positive regulation of cellular process
GO:0051052	0.753	regulation of DNA metabolic process
GO:0048511	0.741	rhythmic process
GO:0007275	0.725	multicellular organism development
GO:0035295	0.715	tube development
GO:0048731	0.686	system development
GO:0009888	0.673	tissue development
GO:0045934	0.665	negative regulation of nucleobase-containing compound metabolic process
GO:0009893	0.599	positive regulation of metabolic process
GO:0010604	0.575	positive regulation of macromolecule metabolic process
GO:0051173	0.574	positive regulation of nitrogen compound metabolic process
GO:0061138	0.566	morphogenesis of a branching epithelium
GO:1903506	0.558	regulation of nucleic acid-templated transcription
GO:0006355	0.554	regulation of DNA-templated transcription
GO:0048754	0.551	branching morphogenesis of an epithelial tube
GO:0045935	0.535	positive regulation of nucleobase-containing compound metabolic process
GO:0048513	0.514	animal organ development
GO:0007049	0.513	cell cycle
GO:0022402	0.503	cell cycle process
GO:0051054	0.498	positive regulation of DNA metabolic process
GO:0009890	0.475	negative regulation of biosynthetic process
GO:0008152	0.425	metabolic process
GO:0071704	0.406	organic substance metabolic process
GO:0048583	0.404	regulation of response to stimulus
GO:1903507	0.343	negative regulation of nucleic acid-templated transcription
GO:0044238	0.340	primary metabolic process
GO:0007623	0.339	circadian rhythm
GO:0043170	0.331	macromolecule metabolic process
GO:0006807	0.328	nitrogen compound metabolic process
GO:2001020	0.328	regulation of response to DNA damage stimulus
GO:0042753	0.319	positive regulation of circadian rhythm
GO:0044237	0.312	cellular metabolic process
GO:0006282	0.303	regulation of DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.990	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005694	0.940	chromosome
GO:0032991	0.472	protein-containing complex
GO:0035861	0.434	site of double-strand break
GO:0005737	0.411	cytoplasm
GO:0000785	0.392	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]