StarFunc result for job id Q9UNW1

User Input

>input (487 residues)
MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVL
LSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGAS
STGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLI
TSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVE
KNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPI
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARA
NSTSDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNW1	1.000	1.000	3.226E-82	487	1.000	1.000	Q9UNW1.pdb.gz	MINP1_HUMAN Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 PE=1 SV=1
2	AFDB:O35217	0.908	0.919	8.782E-69	481	0.830	0.840	O35217.pdb.gz	MINP1_RAT Multiple inositol polyphosphate phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Minpp1 PE=1 SV=3
3	AFDB:F1NPQ2	0.822	0.893	2.346E-50	448	0.536	0.583	F1NPQ2.pdb.gz	MINP1_CHICK Multiple inositol polyphosphate phosphatase 1 OS=Gallus gallus OX=9031 GN=MINPP1 PE=1 SV=3
4	AFDB:Q9VV72	0.712	0.740	1.768E-25	467	0.240	0.251	Q9VV72.pdb.gz	MINP1_DROME Multiple inositol polyphosphate phosphatase 1 OS=Drosophila melanogaster OX=7227 GN=Mipp1 PE=1 SV=2
5	AFDB:Q54ND5	0.759	0.588	1.018E-24	635	0.230	0.176	Q54ND5.pdb.gz	MINP1_DICDI Multiple inositol polyphosphate phosphatase 1 OS=Dictyostelium discoideum OX=44689 GN=mipp1 PE=1 SV=1
6	AFDB:Q941B2	0.759	0.759	8.158E-24	487	0.234	0.234	Q941B2.pdb.gz	Q941B2_ARATH At1g09870/F21M12_26 OS=Arabidopsis thaliana OX=3702 GN=At1g09870 PE=1 SV=1
7	AFDB:A2QIG7	0.695	0.723	1.305E-17	467	0.179	0.186	A2QIG7.pdb.gz	A2QIG7_ASPNC 3-phytase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=phyA PE=3 SV=1
8	AFDB:P08091	0.687	0.735	3.205E-17	453	0.175	0.188	P08091.pdb.gz	PPA1_SCHPO Acid phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pho1 PE=2 SV=1
9	AFDB:Q01682	0.694	0.727	8.253E-17	463	0.193	0.203	Q01682.pdb.gz	PPA2_SCHPO Thiamine-repressible acid phosphatase pho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pho4 PE=1 SV=1
10	AFDB:P00635	0.646	0.671	3.411E-16	467	0.197	0.206	P00635.pdb.gz	PPA5_YEAST Repressible acid phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO5 PE=1 SV=2
11	PDB:1nd6B	0.461	0.623	6.603E-9	343	0.131	0.187	1nd6B.pdb.gz	Crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design
12	PDB:4jodA	0.492	0.614	1.960E-8	378	0.136	0.175	4jodA.pdb.gz
13	PDB:1nt4A	0.460	0.554	2.729E-8	391	0.125	0.156	1nt4A.pdb.gz	Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
14	PDB:1rptA	0.469	0.632	1.898E-7	342	0.136	0.193	1rptA.pdb.gz	Crystal structures of rat acid phosphatase complexed with the transition-state analogs vanadate and molybdate. Implications for the reaction mechanism.
15	PDB:7z32A	0.457	0.528	1.898E-7	412	0.142	0.167	7z32A.pdb.gz
16	PDB:6yj6C	0.237	0.330	3.445E-2	330	0.103	0.152	6yj6C.pdb.gz
17	PDB:6s2rA	0.212	0.397	3.970E-2	234	0.072	0.150	6s2rA.pdb.gz
18	PDB:4embA	0.222	0.385	5.030E-2	245	0.084	0.167	4embA.pdb.gz
19	PDB:2h4zA	0.216	0.372	7.343E-2	255	0.094	0.180	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
20	PDB:2yn2A	0.212	0.368	1.178E-1	254	0.101	0.193	2yn2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35217	0.0	808	481	0.795	0.805	MINP1_RAT Multiple inositol polyphosphate phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Minpp1 PE=1 SV=3
2	Q9UNW1	0.0	1014	487	1.000	1.000	MINP1_HUMAN Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 PE=1 SV=1
3	F1NPQ2	4.54e-173	496	448	0.540	0.587	MINP1_CHICK Multiple inositol polyphosphate phosphatase 1 OS=Gallus gallus OX=9031 GN=MINPP1 PE=1 SV=3
4	Q941B2	1.27e-38	149	487	0.224	0.224	Q941B2_ARATH At1g09870/F21M12_26 OS=Arabidopsis thaliana OX=3702 GN=At1g09870 PE=1 SV=1
5	Q54ND5	3.53e-28	120	635	0.207	0.159	MINP1_DICDI Multiple inositol polyphosphate phosphatase 1 OS=Dictyostelium discoideum OX=44689 GN=mipp1 PE=1 SV=1
6	Q9VV72	8.88e-26	112	467	0.238	0.248	MINP1_DROME Multiple inositol polyphosphate phosphatase 1 OS=Drosophila melanogaster OX=7227 GN=Mipp1 PE=1 SV=2
7	P35842	3.95e-13	73.6	467	0.228	0.238	PPAB_YEAST Acid phosphatase PHO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO11 PE=1 SV=1
8	P00635	4.35e-13	73.6	467	0.226	0.236	PPA5_YEAST Repressible acid phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO5 PE=1 SV=2
9	P38693	2.91e-12	70.9	467	0.222	0.231	PPAC_YEAST Acid phosphatase PHO12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO12 PE=1 SV=1
10	P24031	3.32e-11	67.4	467	0.218	0.227	PPA3_YEAST Constitutive acid phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO3 PE=1 SV=2
11	P08091	3.46e-10	64.3	453	0.187	0.201	PPA1_SCHPO Acid phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pho1 PE=2 SV=1
12	A2QIG7	6.06e-10	63.5	467	0.168	0.176	A2QIG7_ASPNC 3-phytase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=phyA PE=3 SV=1
13	P52290	2.81e-08	58.5	468	0.197	0.205	PPAD_YEAST Probable acid phosphatase DIA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIA3 PE=3 SV=1
14	Q01682	9.69e-08	56.6	463	0.175	0.184	PPA2_SCHPO Thiamine-repressible acid phosphatase pho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pho4 PE=1 SV=1
15	Q59UY6	3.17e-05	48.5	462	0.183	0.193	Q59UY6_CANAL acid phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO113 PE=3 SV=1
16	Q5AMR2	7.02e-05	47.8	456	0.113	0.121	Q5AMR2_CANAL acid phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO114 PE=3 SV=1
17	A0A1D8PS71	6.57e-04	44.7	461	0.172	0.182	A0A1D8PS71_CANAL acid phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO112 PE=3 SV=1
18	A2QSK3	6.64e-04	44.7	479	0.103	0.104	A2QSK3_ASPNC 3-phytase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=phyB PE=3 SV=1
19	F4JLE5	2.4	33.1	554	0.047	0.042	SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana OX=3702 GN=SFH1 PE=2 SV=1
20	P50452	2.8	32.7	374	0.068	0.088	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00328 His_Phos_2	1.6e-30	118.3	Histidine phosphatase superfamily (branch 2)
2	PF11778 SID	62	15.1	Septation initiation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347792	0.935	Synaptojanin-2
2	9606.ENSP00000363046	0.935	Inositol polyphosphate multikinase
3	9606.ENSP00000357583	0.933	Type I inositol 1,4,5-trisphosphate 5-phosphatase
4	9606.ENSP00000267615	0.931	Inositol-tetrakisphosphate 1-kinase
5	9606.ENSP00000360154	0.927	Inositol polyphosphate 5-phosphatase OCRL-1
6	9606.ENSP00000263370	0.925	Inositol-trisphosphate 3-kinase C
7	9606.ENSP00000411152	0.924	Inositol-trisphosphate 3-kinase B
8	9606.ENSP00000260386	0.923	Inositol-trisphosphate 3-kinase A
9	9606.ENSP00000409667	0.921	Synaptojanin-1
10	9606.ENSP00000298229	0.915	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
11	9606.ENSP00000413937	0.915	Inositol polyphosphate 5-phosphatase K
12	9606.ENSP00000376840	0.914	Bisphosphoglycerate mutase
13	9606.ENSP00000333262	0.911	Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
14	9606.ENSP00000362115	0.911	Type II inositol 1,4,5-trisphosphate 5-phosphatase
15	9606.ENSP00000354519	0.902	Phosphatidylinositide phosphatase SAC2
16	9606.ENSP00000359991	0.901	Phosphoglycerate mutase 1
17	9606.ENSP00000379739	0.901	Actin-binding protein IPP
18	9606.ENSP00000412189	0.901	Phosphoglycerate mutase family member 4
19	9606.ENSP00000234590	0.900	Alpha-enolase
20	9606.ENSP00000297283	0.900	Phosphoglycerate mutase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0052743	1.000	inositol tetrakisphosphate phosphatase activity
GO:0030351	1.000	inositol-1,3,4,5,6-pentakisphosphate 3-phosphatase activity
GO:0005488	0.996	binding
GO:0005515	0.994	protein binding
GO:0140096	0.885	catalytic activity, acting on a protein
GO:0004721	0.862	phosphoprotein phosphatase activity
GO:0034416	0.583	bisphosphoglycerate phosphatase activity
GO:0004446	0.583	inositol-hexakisphosphate phosphatase activity
GO:0051717	0.466	inositol-1,3,4,5-tetrakisphosphate 3-phosphatase activity
GO:0034417	0.463	bisphosphoglycerate 3-phosphatase activity
GO:0052826	0.463	inositol hexakisphosphate 2-phosphatase activity
GO:0101006	0.463	protein histidine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043647	0.997	inositol phosphate metabolic process
GO:0043436	0.611	oxoacid metabolic process
GO:0044238	0.586	primary metabolic process
GO:0065007	0.340	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0005737	0.998	cytoplasm
GO:0031982	0.998	vesicle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0043230	0.997	extracellular organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0070062	0.993	extracellular exosome
GO:0005783	0.989	endoplasmic reticulum
GO:0005788	0.930	endoplasmic reticulum lumen
GO:0016020	0.827	membrane
GO:0005829	0.822	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
EC:3.1.3.62	0.583	multiple inositol-polyphosphate phosphatase.
RHEA:27381	0.463	(2R)-2,3-bisphosphoglycerate + H2O = (2R)-2-phosphoglycerate + phosphate
EC:3.1.3.80	0.463	2,3-bisphosphoglycerate 3-phosphatase.
RHEA:47964	0.463	H2O + N(pros)-phospho-L-histidyl-[protein] = L-histidyl-[protein] + phosphate
EC:3.9.1.3	0.463	phosphohistidine phosphatase.

[back to server]