StarFunc result for job id Q9UNX3

User Input

>input (145 residues)
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILE
RKAKSRQVGKEKGKYKEELIEKMQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12749	0.995	0.995	1.033E-27	145	0.979	0.979	P12749.pdb.gz	RL26_RAT Large ribosomal subunit protein uL24 OS=Rattus norvegicus OX=10116 GN=Rpl26 PE=1 SV=1
2	PDB:7f5sLY	0.913	0.987	6.406E-25	134	0.917	0.993	7f5sLY.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
3	AFDB:Q9VVU2	0.914	0.890	1.181E-23	149	0.717	0.698	Q9VVU2.pdb.gz	Q9VVU2_DROME GEO07453p1 OS=Drosophila melanogaster OX=7227 GN=RpL26 PE=1 SV=1
4	AFDB:P51414	0.898	0.892	1.201E-22	146	0.703	0.699	P51414.pdb.gz	RL261_ARATH Large ribosomal subunit protein uL24z OS=Arabidopsis thaliana OX=3702 GN=RPL26A PE=2 SV=2
5	AFDB:Q9FJX2	0.898	0.892	1.768E-22	146	0.655	0.651	Q9FJX2.pdb.gz	RL262_ARATH Large ribosomal subunit protein uL24y OS=Arabidopsis thaliana OX=3702 GN=RPL26B PE=2 SV=1
6	PDB:4v6wCY	0.837	0.924	3.912E-20	131	0.655	0.725	4v6wCY.pdb.gz	Structures of the human and Drosophila 80S ribosome.
7	AFDB:Q38D25	0.819	0.830	2.572E-19	143	0.552	0.559	Q38D25.pdb.gz	Q38D25_TRYB2 60S ribosomal protein L26, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4850 PE=1 SV=1
8	AFDB:P78946	0.827	0.951	1.132E-18	126	0.510	0.587	P78946.pdb.gz	RL26_SCHPO Large ribosomal subunit protein uL24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl26 PE=1 SV=1
9	AFDB:P05743	0.826	0.942	1.310E-17	127	0.448	0.512	P05743.pdb.gz	RL26A_YEAST Large ribosomal subunit protein uL24A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL26A PE=1 SV=3
10	AFDB:A0A1D8PCQ5	0.825	0.941	1.398E-17	127	0.483	0.551	A0A1D8PCQ5.pdb.gz	RL26B_CANAL Large ribosomal subunit protein uL24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPL26B PE=1 SV=1
11	PDB:7pzy9	0.821	0.943	2.625E-17	126	0.483	0.556	7pzy9.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
12	PDB:4v8mBZ	0.764	0.886	5.178E-15	124	0.517	0.605	4v8mBZ.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	PDB:2ww9L	0.705	0.794	5.269E-14	127	0.448	0.512	2ww9L.pdb.gz	Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
14	AFDB:Q3SYS0	0.333	0.230	3.130E-4	216	0.166	0.111	Q3SYS0.pdb.gz	RM24_BOVIN Large ribosomal subunit protein uL24m OS=Bos taurus OX=9913 GN=MRPL24 PE=1 SV=1
15	AFDB:P9WHB7	0.357	0.483	4.914E-4	105	0.159	0.219	P9WHB7.pdb.gz	RL24_MYCTU Large ribosomal subunit protein uL24 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rplX PE=1 SV=1
16	PDB:7kgbU	0.356	0.552	2.944E-3	90	0.145	0.233	7kgbU.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
17	PDB:3p8bB	0.302	0.298	3.140E-3	147	0.097	0.095	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
18	PDB:7zq6u	0.361	0.559	3.140E-3	91	0.138	0.220	7zq6u.pdb.gz	Modulating co-translational protein folding by rational design and ribosome engineering.
19	PDB:4v6iBU	0.281	0.257	6.380E-3	160	0.172	0.156	4v6iBU.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
20	PDB:4zn3A	0.315	0.311	8.806E-3	147	0.103	0.102	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UNX3	6.72e-102	290	145	1.000	1.000	RL26L_HUMAN Ribosomal protein uL24-like OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1
2	P61254	7.43e-101	287	145	0.986	0.986	RL26_HUMAN Large ribosomal subunit protein uL24 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1
3	P61255	7.43e-101	287	145	0.986	0.986	RL26_MOUSE Large ribosomal subunit protein uL24 OS=Mus musculus OX=10090 GN=Rpl26 PE=1 SV=1
4	P12749	1.14e-99	284	145	0.979	0.979	RL26_RAT Large ribosomal subunit protein uL24 OS=Rattus norvegicus OX=10116 GN=Rpl26 PE=1 SV=1
5	Q7SXA1	1.93e-94	271	145	0.945	0.945	Q7SXA1_DANRE 60S ribosomal protein L26 OS=Danio rerio OX=7955 GN=atp6v0e1 PE=1 SV=1
6	Q9VVU2	3.08e-75	222	149	0.724	0.705	Q9VVU2_DROME GEO07453p1 OS=Drosophila melanogaster OX=7227 GN=RpL26 PE=1 SV=1
7	P51414	2.45e-64	194	146	0.690	0.685	RL261_ARATH Large ribosomal subunit protein uL24z OS=Arabidopsis thaliana OX=3702 GN=RPL26A PE=2 SV=2
8	Q9FJX2	2.45e-61	187	146	0.655	0.651	RL262_ARATH Large ribosomal subunit protein uL24y OS=Arabidopsis thaliana OX=3702 GN=RPL26B PE=2 SV=1
9	Q57YL9	5.30e-49	155	143	0.545	0.552	Q57YL9_TRYB2 60S ribosomal protein L26, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.540 PE=3 SV=1
10	Q38D25	6.05e-49	155	143	0.545	0.552	Q38D25_TRYB2 60S ribosomal protein L26, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4850 PE=1 SV=1
11	P78946	1.09e-47	152	126	0.510	0.587	RL26_SCHPO Large ribosomal subunit protein uL24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl26 PE=1 SV=1
12	A0A1D8PCQ5	7.29e-43	139	127	0.483	0.551	RL26B_CANAL Large ribosomal subunit protein uL24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPL26B PE=1 SV=1
13	P05743	5.04e-42	137	127	0.441	0.504	RL26A_YEAST Large ribosomal subunit protein uL24A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL26A PE=1 SV=3
14	P53221	5.16e-42	137	127	0.441	0.504	RL26B_YEAST Large ribosomal subunit protein uL24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL26B PE=1 SV=2
15	A0A140VJI9	6.7	28.9	333	0.179	0.078	A0A140VJI9_HUMAN Non-structural maintenance of chromosomes element 4 OS=Homo sapiens OX=9606 PE=2 SV=1
16	Q8N140	6.7	28.9	333	0.179	0.078	EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens OX=9606 GN=EID3 PE=1 SV=1
17	O08749	9.0	28.5	509	0.200	0.057	DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dld PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05289 BLYB	2.3e+02	13.4	Borrelia hemolysin accessory protein
2	PF00467 KOW	0.0001	33.3	KOW motif
3	PF16906 Ribosomal_L26	3.9e-39	144.3	Ribosomal proteins L26 eukaryotic, L24P archaeal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003814046.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008964764.1	0.992	Belongs to the eukaryotic ribosomal protein eL27 family.
2	9597.XP_003828658.1	0.991	Ubiquitin-like protein fubi and ribosomal protein S30
3	9597.XP_003828045.1	0.989	60S ribosomal protein L4
4	9597.XP_003810808.1	0.986	Belongs to the universal ribosomal protein uL5 family.
5	9597.XP_003832232.1	0.986	Ribosomal protein L9
6	9597.XP_003814749.1	0.985	Belongs to the universal ribosomal protein uS3 family.
7	9597.XP_003819444.1	0.985	Ribosomal protein L8
8	9597.XP_003809884.1	0.984	Belongs to the eukaryotic ribosomal protein eL19 family.
9	9597.XP_008970169.1	0.984	Ribosomal protein L37a
10	9597.XP_003806493.1	0.983	Ribosomal protein L35a
11	9597.XP_003831370.1	0.983	60S ribosomal protein L7 isoform X1
12	9597.XP_003808104.1	0.982	Ribosomal protein L35
13	9597.XP_003809888.1	0.982	Belongs to the universal ribosomal protein uL14 family.
14	9597.XP_003826212.1	0.982	Belongs to the eukaryotic ribosomal protein eL15 family.
15	9597.XP_008950805.1	0.982	Belongs to the universal ribosomal protein uL22 family.
16	9597.XP_008973956.1	0.982	Ribosomal protein L22
17	9597.XP_003814375.1	0.981	Belongs to the universal ribosomal protein uL13 family.
18	9597.XP_003809579.1	0.980	60S ribosomal protein L39
19	9597.XP_008958754.1	0.980	60S ribosomal protein L5
20	9597.XP_008964170.1	0.980	Belongs to the eukaryotic ribosomal protein eL38 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003735	1.000	structural constituent of ribosome
GO:0005515	0.999	protein binding
GO:0003723	0.988	RNA binding
GO:0003729	0.322	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009314	0.979	response to radiation
GO:0009987	0.976	cellular process
GO:0008152	0.944	metabolic process
GO:0065007	0.933	biological regulation
GO:0006950	0.931	response to stress
GO:0050789	0.905	regulation of biological process
GO:0071704	0.904	organic substance metabolic process
GO:0050794	0.902	regulation of cellular process
GO:0044238	0.889	primary metabolic process
GO:0051716	0.886	cellular response to stimulus
GO:0044237	0.884	cellular metabolic process
GO:0006807	0.876	nitrogen compound metabolic process
GO:0033554	0.843	cellular response to stress
GO:0043170	0.842	macromolecule metabolic process
GO:0007154	0.826	cell communication
GO:0034641	0.762	cellular nitrogen compound metabolic process
GO:0048518	0.717	positive regulation of biological process
GO:0010467	0.713	gene expression
GO:0104004	0.711	cellular response to environmental stimulus
GO:0044260	0.689	cellular macromolecule metabolic process
GO:0019538	0.685	protein metabolic process
GO:0048522	0.672	positive regulation of cellular process
GO:0044249	0.663	cellular biosynthetic process
GO:1901576	0.662	organic substance biosynthetic process
GO:2001020	0.618	regulation of response to DNA damage stimulus
GO:0006412	0.618	translation
GO:0048523	0.585	negative regulation of cellular process
GO:0002181	0.577	cytoplasmic translation
GO:1901796	0.534	regulation of signal transduction by p53 class mediator
GO:0007093	0.495	mitotic cell cycle checkpoint signaling
GO:0042981	0.443	regulation of apoptotic process
GO:0009605	0.417	response to external stimulus
GO:0010212	0.417	response to ionizing radiation
GO:0000077	0.397	DNA damage checkpoint signaling
GO:0071479	0.396	cellular response to ionizing radiation
GO:0032501	0.350	multicellular organismal process
GO:1901991	0.349	negative regulation of mitotic cell cycle phase transition
GO:0072331	0.330	signal transduction by p53 class mediator
GO:0019222	0.320	regulation of metabolic process
GO:0009416	0.318	response to light stimulus
GO:0071840	0.316	cellular component organization or biogenesis
GO:1990928	0.316	response to amino acid starvation
GO:0032502	0.309	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0022626	0.999	cytosolic ribosome
GO:0015934	0.999	large ribosomal subunit
GO:0043227	0.994	membrane-bounded organelle
GO:0022625	0.990	cytosolic large ribosomal subunit
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005576	0.966	extracellular region
GO:0016020	0.961	membrane
GO:0070013	0.941	intracellular organelle lumen
GO:0005615	0.922	extracellular space
GO:0031982	0.906	vesicle
GO:0005634	0.881	nucleus
GO:1903561	0.855	extracellular vesicle
GO:0070062	0.853	extracellular exosome
GO:0031981	0.841	nuclear lumen
GO:0005654	0.456	nucleoplasm
GO:0012505	0.395	endomembrane system
GO:0030054	0.369	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]