StarFunc result for job id Q9UNY4

User Input

>input (1162 residues)
MEEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVEL
QGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSN
WLRNPFKVLDKNQEPALWKQLIKGEGEEKKADKKQREKGDQLFDQKKEQKPEMMEKDLSS
GLVPKKKQSVVQEKKQEEGAEIQCEAETGGTHKRDFSEIKSQQCQGNELTRPSASSQEKS
SGKSQDVQRESEPLREKVTQLLPQNVHSHNSISKPQKGGPLNKEYTNWEAKETKAKDGPS
IQATQKSLPQGHFQERPETHSVPAPGGPAAQAAPAAPGLSLGEGREAATSSDDEEEDDVV
FVSSKPGSPLLFDSTLDLETKENLQFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQ
LKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFT
KTTTGPPHLVPPQPLPRRGTQPVGSLELKSACQVTAGGSSQCYRGHTNQDHVHAVWKITS
EAIGQLHRSLESCPGETVVAEDPAGLKVPLLLHQKQALAWLLWRESQKPQGGILADDMGL
GKTLTMIALILTQKNQEKKEEKEKSTALTWLSKDDSCDFTSHGTLIICPASLIHHWKNEV
EKRVNSNKLRVYLYHGPNRDSRARVLSTYDIVITTYSLVAKEIPTNKQEAEIPGANLNVE
GTSTPLLRIAWARIILDEAHNVKNPRVQTSIAVCKLQACARWAVTGTPIQNNLLDMYSLL
KFLRCSPFDEFNLWRSQVDNGSKKGGERLSILTKSLLLRRTKDQLDSTGRPLVILPQRKF
QLHHLKLSEDEETVYNVFFARSRSALQSYLKRHESRGNQSGRSPNNPFSRVALEFGSEEP
RHSEAADSPRSSTVHILSQLLRLRQCCCHLSLLKSALDPMELKGEGLVLSLEEQLSALTL
SELRDSEPSSTVSLNGTFFKMELFEGMRESTKISSLLAELEAIQRNSASQKSVIVSQWTN
MLKVVALHLKKHGLTYATIDGSVNPKQRMDLVEAFNHSRGPQVMLISLLAGGVGLNLTGG
NHLFLLDMHWNPSLEDQACDRIYRVGQQKDVVIHRFVCEGTVEEKILQLQEKKKDLAKQV
LSGSGESVTKLTLADLRVLFGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UNY4	1.000	1.000	0.000	1162	1.000	1.000	Q9UNY4.pdb.gz	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2
2	PDB:7oo3b	0.343	0.715	8.220E-32	534	0.115	0.251	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
3	AFDB:P46100	0.354	0.175	3.833E-31	2492	0.196	0.091	P46100.pdb.gz	ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=6
4	PDB:6jylK	0.345	0.755	9.231E-29	504	0.120	0.278	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
5	PDB:6gejM	0.321	0.523	3.179E-27	688	0.132	0.222	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
6	PDB:6tdaS	0.345	0.500	3.545E-27	783	0.127	0.188	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
7	AFDB:Q9LK10	0.326	0.334	4.724E-27	1132	0.157	0.161	Q9LK10.pdb.gz	CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana OX=3702 GN=CLSY4 PE=1 SV=1
8	PDB:6g0lM	0.307	0.413	7.896E-26	855	0.109	0.149	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
9	PDB:6uxwA	0.336	0.488	1.857E-24	778	0.115	0.172	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
10	PDB:6g0lW	0.317	0.414	3.381E-24	878	0.108	0.144	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
11	PDB:7epuB	0.220	0.303	1.249E-23	748	0.119	0.184	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
12	PDB:7r78A	0.294	0.190	1.900E-22	1880	0.114	0.070	7r78A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
13	PDB:5vvrM	0.300	0.645	4.073E-22	503	0.111	0.256	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
14	AFDB:Q22308	0.218	0.245	3.118E-11	1022	0.120	0.137	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2
15	AFDB:Q9VGI8	0.224	0.179	5.290E-10	1487	0.113	0.088	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
16	AFDB:Q9M658	0.169	0.103	1.738E-5	2001	0.108	0.063	Q9M658.pdb.gz	MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana OX=3702 GN=MOM1 PE=1 SV=1
17	AFDB:Q7Z333	0.185	0.094	9.397E-5	2677	0.126	0.055	Q7Z333.pdb.gz	SETX_HUMAN Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4
18	AFDB:Q9JLV1	0.039	0.071	1.982E-3	577	0.069	0.139	Q9JLV1.pdb.gz	BAG3_MOUSE BAG family molecular chaperone regulator 3 OS=Mus musculus OX=10090 GN=Bag3 PE=1 SV=2
19	AFDB:Q9Y794	0.084	0.096	3.417E-3	972	0.096	0.114	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
20	AFDB:Q9SLF3	0.062	0.060	7.323E-3	1206	0.109	0.105	Q9SLF3.pdb.gz	TC132_ARATH Translocase of chloroplast 132, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC132 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UNY4	0.0	2394	1162	1.000	1.000	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2
2	P34739	7.38e-154	489	1061	0.261	0.286	TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster OX=7227 GN=lds PE=1 SV=2
3	Q10332	2.29e-87	303	830	0.188	0.264	YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC582.10c PE=1 SV=1
4	Q9FNI6	3.59e-83	295	1029	0.175	0.197	SM3L2_ARATH DNA repair protein RAD5A OS=Arabidopsis thaliana OX=3702 GN=RAD5A PE=1 SV=1
5	Q9FIY7	7.44e-83	298	1277	0.169	0.153	SM3L3_ARATH DNA repair protein RAD5B OS=Arabidopsis thaliana OX=3702 GN=RAD5B PE=3 SV=1
6	Q9VHY2	8.95e-82	290	945	0.170	0.210	Q9VHY2_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10445 PE=4 SV=2
7	A0A0B4LGT5	9.99e-82	290	944	0.170	0.210	A0A0B4LGT5_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10445 PE=4 SV=1
8	P31244	2.29e-72	259	790	0.162	0.238	RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD16 PE=1 SV=1
9	P79051	1.17e-70	256	861	0.167	0.225	RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp16 PE=3 SV=2
10	Q6PCN7	1.21e-70	258	1003	0.147	0.170	HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus OX=10090 GN=Hltf PE=1 SV=1
11	Q95216	6.78e-61	229	1005	0.145	0.168	HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus OX=9986 GN=HLTF PE=1 SV=1
12	Q94BR5	3.26e-51	199	981	0.121	0.144	CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana OX=3702 GN=CHR28 PE=1 SV=1
13	B5BT18	8.55e-51	199	2045	0.144	0.082	BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana OX=3702 GN=BTAF1 PE=1 SV=1
14	F4HTG1	2.99e-49	193	1280	0.112	0.102	F4HTG1_ARATH SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=EDA16 PE=1 SV=1
15	Q9LHE4	6.15e-49	192	1047	0.112	0.124	CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana OX=3702 GN=CHR27 PE=1 SV=1
16	O13762	1.88e-46	183	897	0.115	0.149	YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17A2.12 PE=3 SV=1
17	P32333	1.45e-45	182	1867	0.147	0.092	BTAF1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MOT1 PE=1 SV=1
18	O43065	2.18e-45	182	1953	0.143	0.085	BTAF1_SCHPO TATA-binding protein-associated factor mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mot1 PE=1 SV=4
19	Q54M42	9.29e-45	180	2005	0.143	0.083	Q54M42_DICDI SNF2-related domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286219 PE=4 SV=1
20	Q9Y620	3.25e-44	176	910	0.142	0.181	RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens OX=9606 GN=RAD54B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00271 Helicase_C	7.2e-11	53.8	Helicase conserved C-terminal domain
2	PF04851 ResIII	6.6e-07	41.0	Type III restriction enzyme, res subunit
3	PF00176 SNF2-rel_dom	3.1e-69	244.9	SNF2-related domain
4	PF18766 SWI2_SNF2	1.3e+02	13.6	SWI2/SNF2 ATPase
5	PF06839 zf-GRF	0.018	26.4	GRF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263431	0.800	Protein kinase C gamma type
2	9606.ENSP00000305355	0.800	Protein kinase C beta type
3	9606.ENSP00000309591	0.800	cAMP-dependent protein kinase catalytic subunit alpha
4	9606.ENSP00000359719	0.800	cAMP-dependent protein kinase catalytic subunit beta
5	9606.ENSP00000366488	0.800	cAMP-dependent protein kinase catalytic subunit gamma
6	9606.ENSP00000408695	0.800	Protein kinase C alpha type
7	9606.ENSP00000360532	0.799	Cell division cycle 5-like protein
8	9606.ENSP00000371253	0.793	Trifunctional purine biosynthetic protein adenosine-3
9	9606.ENSP00000296503	0.689	High mobility group protein B2
10	9606.ENSP00000251496	0.686	Condensin complex subunit 3
11	9606.ENSP00000382058	0.611	DNA-directed RNA polymerase III subunit RPC7
12	9606.ENSP00000245544	0.606	Nuclear pore complex protein Nup85
13	9606.ENSP00000313490	0.598	Phosphoribosylformylglycinamidine synthase
14	9606.ENSP00000364126	0.592	DNA-(apurinic or apyrimidinic site) lyase 2
15	9606.ENSP00000382595	0.586	Multifunctional protein ADE2
16	9606.ENSP00000360268	0.572	Delta-1-pyrroline-5-carboxylate synthase
17	9606.ENSP00000236959	0.565	Bifunctional purine biosynthesis protein PURH
18	9606.ENSP00000340823	0.555	General transcription factor IIF subunit 2
19	9606.ENSP00000345347	0.555	High mobility group protein B1
20	9606.ENSP00000353741	0.551	Eukaryotic peptide chain release factor subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:1901363	0.471	heterocyclic compound binding
GO:0097159	0.471	organic cyclic compound binding
GO:0003676	0.459	nucleic acid binding
GO:0003677	0.431	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006139	0.996	nucleobase-containing compound metabolic process
GO:0090304	0.994	nucleic acid metabolic process
GO:0044271	0.979	cellular nitrogen compound biosynthetic process
GO:1901362	0.975	organic cyclic compound biosynthetic process
GO:0018130	0.974	heterocycle biosynthetic process
GO:0019438	0.966	aromatic compound biosynthetic process
GO:0034654	0.950	nucleobase-containing compound biosynthetic process
GO:0016070	0.912	RNA metabolic process
GO:0010467	0.909	gene expression
GO:0009059	0.881	macromolecule biosynthetic process
GO:0006351	0.865	DNA-templated transcription
GO:0006366	0.787	transcription by RNA polymerase II
GO:0006353	0.714	DNA-templated transcription termination
GO:0065007	0.629	biological regulation
GO:0050789	0.566	regulation of biological process
GO:0050794	0.532	regulation of cellular process
GO:0050896	0.469	response to stimulus
GO:0051716	0.428	cellular response to stimulus
GO:0006950	0.391	response to stress
GO:0019222	0.323	regulation of metabolic process
GO:0060255	0.312	regulation of macromolecule metabolic process
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.995	protein-containing complex
GO:0140513	0.944	nuclear protein-containing complex
GO:0043232	0.697	intracellular non-membrane-bounded organelle
GO:0008023	0.501	transcription elongation factor complex
GO:0005694	0.364	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]