StarFunc result for job id Q9UP38

User Input

>input (647 residues)
MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSG
CYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVG
LNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVF
SVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UP38	1.000	1.000	1.400E-94	647	1.000	1.000	Q9UP38.pdb.gz	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
2	AFDB:O75084	0.694	0.776	1.785E-68	574	0.689	0.777	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
3	AFDB:Q9PUK8	0.659	0.761	1.123E-67	549	0.668	0.787	Q9PUK8.pdb.gz	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
4	AFDB:Q08464	0.585	0.662	1.657E-66	570	0.680	0.772	Q08464.pdb.gz	FZD2_RAT Frizzled-2 OS=Rattus norvegicus OX=10116 GN=Fzd2 PE=1 SV=1
5	AFDB:Q6NV44	0.745	0.857	6.657E-66	559	0.669	0.775	Q6NV44.pdb.gz	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
6	AFDB:A7YYJ5	0.587	0.679	8.209E-65	557	0.660	0.767	A7YYJ5.pdb.gz
7	AFDB:F1QBI2	0.613	0.705	2.635E-64	550	0.631	0.742	F1QBI2.pdb.gz
8	AFDB:P18537	0.549	0.609	7.865E-50	581	0.427	0.475	P18537.pdb.gz	FRIZ_DROME Frizzled OS=Drosophila melanogaster OX=7227 GN=fz PE=1 SV=1
9	AFDB:Q9PTT7	0.509	0.566	6.983E-45	579	0.427	0.477	Q9PTT7.pdb.gz
10	AFDB:O93274	0.510	0.566	2.143E-44	581	0.431	0.480	O93274.pdb.gz	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
11	PDB:7evwR	0.498	0.925	9.668E-34	340	0.450	0.856	7evwR.pdb.gz
12	PDB:7e32R	0.268	0.544	6.985E-6	285	0.070	0.158	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:6wwzR	0.342	0.637	3.511E-5	310	0.071	0.148	6wwzR.pdb.gz
14	PDB:3aymA	0.318	0.544	4.394E-5	350	0.056	0.103	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
15	PDB:7w2zR	0.267	0.494	6.291E-5	301	0.070	0.150	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
16	PDB:7x9yR	0.297	0.561	1.030E-4	293	0.060	0.133	7x9yR.pdb.gz
17	PDB:7vl9R	0.288	0.535	1.688E-4	302	0.065	0.139	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
18	PDB:7jvrR	0.297	0.655	1.846E-4	269	0.059	0.141	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
19	PDB:8ef5M	0.296	0.584	2.020E-4	288	0.051	0.115	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
20	PDB:7finR	0.280	0.439	2.112E-4	380	0.070	0.118	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70421	0.0	1117	642	0.929	0.936	FZD1_MOUSE Frizzled-1 OS=Mus musculus OX=10090 GN=Fzd1 PE=1 SV=3
2	O75084	0.0	907	574	0.685	0.772	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
3	Q08463	0.0	1100	641	0.921	0.930	FZD1_RAT Frizzled-1 OS=Rattus norvegicus OX=10116 GN=Fzd1 PE=1 SV=1
4	Q08464	0.0	880	570	0.671	0.761	FZD2_RAT Frizzled-2 OS=Rattus norvegicus OX=10116 GN=Fzd2 PE=1 SV=1
5	Q14332	0.0	895	565	0.680	0.779	FZD2_HUMAN Frizzled-2 OS=Homo sapiens OX=9606 GN=FZD2 PE=1 SV=1
6	Q24760	0.0	528	580	0.414	0.462	FRIZ_DROVI Frizzled OS=Drosophila virilis OX=7244 GN=fz PE=2 SV=3
7	Q61090	0.0	901	572	0.685	0.774	FZD7_MOUSE Frizzled-7 OS=Mus musculus OX=10090 GN=Fzd7 PE=1 SV=2
8	Q6NV44	0.0	915	559	0.674	0.780	Q6NV44_DANRE Frizzled class receptor 7a OS=Danio rerio OX=7955 GN=fzd7a PE=2 SV=2
9	Q8AVJ9	0.0	898	548	0.672	0.794	FZD7B_XENLA Frizzled-7-B OS=Xenopus laevis OX=8355 GN=fzd7-b PE=1 SV=1
10	Q8QFM3	0.0	893	557	0.668	0.776	Q8QFM3_DANRE Frizzled 7a OS=Danio rerio OX=7955 GN=fz7b PE=1 SV=1
11	Q90YL7	0.0	853	550	0.634	0.745	Q90YL7_DANRE Frizzled homolog 2 OS=Danio rerio OX=7955 GN=zfz2 PE=2 SV=1
12	Q90ZT3	0.0	910	559	0.671	0.776	Q90ZT3_DANRE Frizzled 7b OS=Danio rerio OX=7955 GN=zg07 PE=2 SV=1
13	Q9JIP6	0.0	897	570	0.680	0.772	FZD2_MOUSE Frizzled-2 OS=Mus musculus OX=10090 GN=Fzd2 PE=2 SV=1
14	Q9PUK8	0.0	908	549	0.675	0.796	FZD7A_XENLA Frizzled-7-A OS=Xenopus laevis OX=8355 GN=fzd7-a PE=1 SV=2
15	Q9UP38	0.0	1335	647	1.000	1.000	FZD1_HUMAN Frizzled-1 OS=Homo sapiens OX=9606 GN=FZD1 PE=1 SV=2
16	Q9YI00	0.0	537	579	0.434	0.485	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
17	B3DIG4	3.28e-180	526	592	0.420	0.459	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
18	O93274	3.51e-180	525	581	0.433	0.482	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
19	P18537	8.44e-178	519	581	0.417	0.465	FRIZ_DROME Frizzled OS=Drosophila melanogaster OX=7227 GN=fz PE=1 SV=1
20	Q9PWK6	3.45e-177	517	576	0.416	0.467	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	0.011	26.6	7 transmembrane receptor (Secretin family)
2	PF05462 Dicty_CAR	0.25	22.1	Slime mold cyclic AMP receptor
3	PF01534 Frizzled	6.7e-142	484.0	Frizzled/Smoothened family membrane region
4	PF01392 Fz	1.3e-28	111.3	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287934

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284523	0.998	Protein Wnt-3a
2	9606.ENSP00000293549	0.992	Proto-oncogene Wnt-1
3	9606.ENSP00000265441	0.989	Protein Wnt-2
4	9606.ENSP00000294304	0.989	Low-density lipoprotein receptor-related protein 5
5	9606.ENSP00000344456	0.988	Catenin beta-1
6	9606.ENSP00000225512	0.987	Proto-oncogene Wnt-3
7	9606.ENSP00000368169	0.985	Segment polarity protein dishevelled homolog DVL-1
8	9606.ENSP00000261349	0.982	Low-density lipoprotein receptor-related protein 6
9	9606.ENSP00000341032	0.980	Protein Wnt-7b
10	9606.ENSP00000264634	0.973	Protein Wnt-5a
11	9606.ENSP00000340677	0.966	Protein Wnt-8b
12	9606.ENSP00000363081	0.964	Dickkopf-related protein 1
13	9606.ENSP00000426653	0.963	Protein Wnt-8a
14	9606.ENSP00000286574	0.957	Wnt inhibitory factor 1
15	9606.ENSP00000285311	0.947	Dickkopf-related protein 2
16	9606.ENSP00000257430	0.943	Adenomatous polyposis coli protein
17	9606.ENSP00000421689	0.942	Casein kinase I isoform alpha
18	9606.ENSP00000290167	0.939	Protein Wnt-4
19	9606.ENSP00000301691	0.939	Sclerostin
20	9606.ENSP00000331242	0.936	Kremen protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0042813	1.000	Wnt receptor activity
GO:0030165	0.997	PDZ domain binding
GO:0005102	0.957	signaling receptor binding
GO:0001664	0.635	G protein-coupled receptor binding
GO:0005109	0.615	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0016055	0.987	Wnt signaling pathway
GO:0048856	0.971	anatomical structure development
GO:0032501	0.965	multicellular organismal process
GO:0060070	0.952	canonical Wnt signaling pathway
GO:0019222	0.898	regulation of metabolic process
GO:0048518	0.873	positive regulation of biological process
GO:0060255	0.873	regulation of macromolecule metabolic process
GO:0007275	0.855	multicellular organism development
GO:0048522	0.851	positive regulation of cellular process
GO:0080090	0.832	regulation of primary metabolic process
GO:0051171	0.831	regulation of nitrogen compound metabolic process
GO:0031323	0.823	regulation of cellular metabolic process
GO:0048731	0.729	system development
GO:0048513	0.681	animal organ development
GO:0010468	0.626	regulation of gene expression
GO:0048519	0.618	negative regulation of biological process
GO:0048583	0.614	regulation of response to stimulus
GO:0010604	0.597	positive regulation of macromolecule metabolic process
GO:0023051	0.584	regulation of signaling
GO:0048523	0.565	negative regulation of cellular process
GO:0010646	0.542	regulation of cell communication
GO:0009966	0.528	regulation of signal transduction
GO:0010556	0.505	regulation of macromolecule biosynthetic process
GO:0031326	0.502	regulation of cellular biosynthetic process
GO:0051252	0.500	regulation of RNA metabolic process
GO:0009653	0.488	anatomical structure morphogenesis
GO:2001141	0.486	regulation of RNA biosynthetic process
GO:0006355	0.480	regulation of DNA-templated transcription
GO:0051173	0.479	positive regulation of nitrogen compound metabolic process
GO:0031325	0.462	positive regulation of cellular metabolic process
GO:0065009	0.446	regulation of molecular function
GO:0009888	0.425	tissue development
GO:0050793	0.420	regulation of developmental process
GO:0048584	0.336	positive regulation of response to stimulus
GO:0051254	0.335	positive regulation of RNA metabolic process
GO:0009891	0.330	positive regulation of biosynthetic process
GO:0010557	0.324	positive regulation of macromolecule biosynthetic process
GO:0030154	0.317	cell differentiation
GO:0045893	0.311	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.797	cytoplasm
GO:0043231	0.769	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]