StarFunc result for job id Q9UP79

User Input

>input (889 residues)
MLPAPAAPRWPPLLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAF
GKGFVLRLAPDDSFLAPEFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCR
GLSGSFLLDGEEFTIQPQGAGGSLAQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERG
DHQEDSEEESQEEEAEGASEPPPPLGATSRTKRFVSEARFVETLLVADASMAAFYGADLQ
NHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGPEVSDNGGLTLRNFCNWQRRF
NQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIEDEGLQAAHT
LAHELGHVLSMPHDDSKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGG
HGDCLLDAPAAALPLPTGLPGRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTD
GAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSR
TCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
TDMDGNLLQWVPKYAGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPETLAICVRGQ
CVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKVSGSLTPTNYGYNDIVTIPAGATNIDVKQ
RSHPGVQNDGNYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIATLERLQSFR
PLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGD
WSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97857	0.741	0.684	0.000	968	0.485	0.445	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
2	AFDB:Q9UHI8	0.752	0.694	0.000	967	0.499	0.459	Q9UHI8.pdb.gz	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
3	AFDB:Q9UP79	1.000	1.000	0.000	889	1.000	1.000	Q9UP79.pdb.gz	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
4	AFDB:P59384	0.627	0.590	3.280E-100	950	0.467	0.437	P59384.pdb.gz	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
5	AFDB:Q9R001	0.624	0.598	4.447E-95	930	0.412	0.394	Q9R001.pdb.gz	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
6	AFDB:Q9P2N4	0.675	0.328	4.140E-91	1935	0.400	0.184	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
7	AFDB:F1R6Q4	0.681	0.431	4.598E-91	1461	0.388	0.236	F1R6Q4.pdb.gz
8	AFDB:P59511	0.681	0.336	1.019E-89	1906	0.399	0.186	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
9	AFDB:Q8BNJ2	0.647	0.689	1.724E-89	833	0.400	0.427	Q8BNJ2.pdb.gz	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
10	AFDB:Q9TT93	0.652	0.688	2.765E-89	839	0.407	0.431	Q9TT93.pdb.gz	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
11	PDB:4q1lA	0.198	0.820	3.528E-11	202	0.062	0.272	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.062	0.116	2.590E-4	442	0.076	0.154	1w0rA.pdb.gz
13	PDB:7ufgA	0.170	0.137	3.032E-4	1151	0.130	0.101	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:7ufgB	0.175	0.140	1.628E-3	1182	0.137	0.103	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:4e0sB	0.060	0.059	1.330E-2	898	0.033	0.032	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:6oj0Z	0.095	0.332	1.558E-2	180	0.016	0.078	6oj0Z.pdb.gz
17	PDB:3afkA	0.085	0.313	1.642E-2	167	0.020	0.108	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
18	PDB:4kncB	0.083	0.159	1.642E-2	419	0.018	0.038	4kncB.pdb.gz
19	PDB:7nycC	0.054	0.059	1.922E-2	809	0.030	0.033	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:3t5oA	0.058	0.059	2.250E-2	871	0.031	0.032	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PUN6	0.0	574	1931	0.332	0.153	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
2	F1SFS3	0.0	573	2000	0.357	0.159	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
3	G3V673	0.0	642	927	0.414	0.397	G3V673_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=4 SV=1
4	O75173	0.0	620	837	0.400	0.425	ATS4_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Homo sapiens OX=9606 GN=ADAMTS4 PE=1 SV=3
5	P59384	0.0	774	950	0.472	0.442	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
6	P59510	0.0	599	1910	0.370	0.172	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
7	P59511	0.0	621	1906	0.389	0.182	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
8	P97857	0.0	860	968	0.501	0.460	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
9	Q6TY19	0.0	644	928	0.422	0.404	Q6TY19_RAT ADAMTS5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=2 SV=1
10	Q8BNJ2	0.0	619	833	0.402	0.429	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
11	Q9ESP7	0.0	577	630	0.341	0.481	ATS4_RAT A disintegrin and metalloproteinase with thrombospondin motifs 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Adamts4 PE=2 SV=2
12	Q9P2N4	0.0	624	1935	0.375	0.172	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
13	Q9R001	0.0	645	930	0.413	0.395	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
14	Q9TT93	0.0	618	839	0.400	0.424	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
15	Q9UHI8	0.0	845	967	0.496	0.456	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
16	Q9UNA0	0.0	637	930	0.400	0.383	ATS5_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Homo sapiens OX=9606 GN=ADAMTS5 PE=1 SV=2
17	Q9UP79	0.0	1826	889	1.000	1.000	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
18	Q9WUQ1	0.0	864	967	0.503	0.462	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
19	Q19791	1.33e-158	514	2150	0.350	0.145	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
20	H2L2A7	5.14e-155	504	2165	0.350	0.144	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	1.6e-18	78.3	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	9.3e-05	33.8	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	9.7e-26	101.7	ADAM-TS Spacer 1
4	PF02031 Peptidase_M7	2.6e+02	13.2	Streptomyces extracellular neutral proteinase (M7) family
5	PF01562 Pep_M12B_propep	8e-15	66.8	Reprolysin family propeptide
6	PF01421 Reprolysin	6e-16	70.5	Reprolysin (M12B) family zinc metalloprotease
7	PF13574 Reprolysin_2	0.015	26.7	Metallo-peptidase family M12B Reprolysin-like
8	PF13582 Reprolysin_3	1.4e-08	46.7	Metallo-peptidase family M12B Reprolysin-like
9	PF13583 Reprolysin_4	9	17.4	Metallo-peptidase family M12B Reprolysin-like
10	PF13688 Reprolysin_5	4.7e-10	51.5	Metallo-peptidase family M12
11	PF19030 TSP1_ADAMTS	2.4e-09	48.6	Thrombospondin type 1 domain
12	PF19035 TSP1_CCN	1.5	20.5	CCN3 Nov like TSP1 domain
13	PF19028 TSP1_spondin	5.9e-05	34.6	Spondin-like TSP1 domain
14	PF00090 TSP_1	4.5e-09	47.7	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.951	Aggrecan core protein
2	9606.ENSP00000258613	0.939	Thrombospondin type-1 domain-containing protein 1
3	9606.ENSP00000260356	0.933	Thrombospondin-1
4	9606.ENSP00000339613	0.927	GDP-fucose protein O-fucosyltransferase 2
5	9606.ENSP00000346478	0.923	ADAMTS-like protein 2
6	9606.ENSP00000360997	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 13
7	9606.ENSP00000274487	0.919	ADAM metallopeptidase with thrombospondin type 1 motif 19
8	9606.ENSP00000270328	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 10
9	9606.ENSP00000355751	0.916	Thrombospondin-2
10	9606.ENSP00000251582	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 2
11	9606.ENSP00000268070	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 17
12	9606.ENSP00000282849	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 18
13	9606.ENSP00000286657	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 3
14	9606.ENSP00000362304	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 14
15	9606.ENSP00000422554	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 12
16	9606.ENSP00000274181	0.913	ADAM metallopeptidase with thrombospondin type 1 motif 16
17	9606.ENSP00000370443	0.912	ADAM metallopeptidase with thrombospondin type 1 motif 6
18	9606.ENSP00000247153	0.911	Properdin
19	9606.ENSP00000373472	0.911	A disintegrin and metalloproteinase with thrombospondin motifs 7
20	9606.ENSP00000299164	0.910	ADAM metallopeptidase with thrombospondin type 1 motif 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008237	1.000	metallopeptidase activity
GO:0004175	0.980	endopeptidase activity
GO:0004222	0.896	metalloendopeptidase activity
GO:0050839	0.597	cell adhesion molecule binding
GO:0005102	0.452	signaling receptor binding
GO:0005178	0.441	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.948	biological regulation
GO:0050789	0.942	regulation of biological process
GO:0009987	0.818	cellular process
GO:0050794	0.780	regulation of cellular process
GO:0048519	0.719	negative regulation of biological process
GO:0048523	0.695	negative regulation of cellular process
GO:0071704	0.570	organic substance metabolic process
GO:0044238	0.556	primary metabolic process
GO:0006807	0.550	nitrogen compound metabolic process
GO:1901564	0.502	organonitrogen compound metabolic process
GO:0043170	0.497	macromolecule metabolic process
GO:0019538	0.467	protein metabolic process
GO:0032502	0.451	developmental process
GO:0048856	0.432	anatomical structure development
GO:0042127	0.411	regulation of cell population proliferation
GO:0032501	0.376	multicellular organismal process
GO:0008285	0.332	negative regulation of cell population proliferation
GO:0050896	0.326	response to stimulus
GO:0071840	0.317	cellular component organization or biogenesis
GO:0016043	0.308	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0031012	0.998	extracellular matrix
GO:0012505	0.996	endomembrane system
GO:0070013	0.995	intracellular organelle lumen
GO:0043227	0.992	membrane-bounded organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005737	0.886	cytoplasm
GO:0062023	0.860	collagen-containing extracellular matrix
GO:0005783	0.849	endoplasmic reticulum
GO:0005615	0.824	extracellular space
GO:0005788	0.775	endoplasmic reticulum lumen
GO:0043230	0.385	extracellular organelle
GO:0065010	0.355	extracellular membrane-bounded organelle
GO:0031982	0.343	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.896	Metalloendopeptidases.

[back to server]