StarFunc result for job id Q9UP95

User Input

>input (1085 residues)
MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGID
YYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRRRAAEAPSMGT
LMGVYLPCLQNIFGVILFLRLTWMVGTAGVLQALLIVLICCCCTLLTAISMSAIATNGVV
PAGGSYFMISRSLGPEFGGAVGLCFYLGTTFAAAMYILGAIEILLTYIAPPAAIFYPSGA
HDTSNATLNNMRVYGTIFLTFMTLVVFVGVKYVNKFASLFLACVIISILSIYAGGIKSIF
DPPVFPVCMLGNRTLSRDQFDICAKTAVVDNETVATQLWSFFCHSPNLTTDSCDPYFMLN
NVTEIPGIPGAAAGVLQENLWSAYLEKGDIVEKHGLPSADAPSLKESLPLYVVADIATSF
TVLVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSLVYFSSVVLFGACIEGV
VLRDKYGDGVSRNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIP
FLRVFGHGKVNGEPTWALLLTALIAELGILIASLDMVAPILSMFFLMCYLFVNLACAVQT
LLRTPNWRPRFKYYHWALSFLGMSLCLALMFVSSWYYALVAMLIAGMIYKYIEYQGAEKE
WGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKYPRLLTFASQLKA
GKGLTIVGSVIQGSFLESYGEAQAAEQTIKNMMEIEKVKGFCQVVVASKVREGLAHLIQS
CGLGGMRHNSVVLGWPYGWRQSEDPRAWKTFIDTVRCTTAAHLALLVPKNIAFYPSNHER
YLEGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQMDDNSIQMKKDLAVFLY
HLRLEAEVEVVEMHNSDISAYTYERTLMMEQRSQMLRQMRLTKTEREREAQLVKDRHSAL
RLESLYSDEEDESAVGADKIQMTWTRDKYMTETWDPSHAPDNFRELVHIKPDQSNVRRMH
TAVKLNEVIVTRSHDARLVLLNMPGPPRNSEGDENYMEFLEVLTEGLERVLLVRGGGREV
ITIYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6m1yA	0.847	0.978	0.000	938	0.712	0.824	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
2	PDB:6m23A	0.835	0.965	0.000	936	0.654	0.759	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
3	PDB:6y5rA	0.774	0.950	0.000	879	0.675	0.833	6y5rA.pdb.gz
4	PDB:7airA	0.763	0.929	0.000	885	0.816	1.000	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
5	AFDB:A0A0B4LGD3	0.848	0.855	0.000	1077	0.555	0.559	A0A0B4LGD3.pdb.gz	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
6	AFDB:A0A2R8RX62	0.918	0.870	0.000	1146	0.676	0.640	A0A2R8RX62.pdb.gz
7	AFDB:E9QC71	0.908	0.883	0.000	1117	0.677	0.658	E9QC71.pdb.gz
8	AFDB:Q28677	0.960	0.960	0.000	1085	0.972	0.972	Q28677.pdb.gz	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
9	AFDB:Q5RK27	0.927	0.929	0.000	1083	0.700	0.701	Q5RK27.pdb.gz	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
10	AFDB:Q63633	0.931	0.887	0.000	1139	0.704	0.671	Q63633.pdb.gz	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
11	AFDB:Q924N4	0.930	0.878	0.000	1150	0.762	0.719	Q924N4.pdb.gz	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
12	AFDB:Q9W1G6	0.852	0.885	0.000	1043	0.555	0.577	Q9W1G6.pdb.gz	Q9W1G6_DROME Kazachoc, isoform A OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2
13	PDB:7d99A	0.794	0.962	8.459E-104	891	0.614	0.747	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
14	AFDB:S6FWN4	0.770	0.725	9.670E-84	1156	0.423	0.397	S6FWN4.pdb.gz	S6FWN4_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-1 PE=1 SV=1
15	AFDB:H2KZC3	0.542	0.524	1.323E-83	1129	0.459	0.441	H2KZC3.pdb.gz	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
16	PDB:7d14A	0.721	0.911	1.160E-77	850	0.569	0.726	7d14A.pdb.gz
17	PDB:7s1xB	0.439	0.528	6.266E-44	871	0.239	0.297	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7d10A	0.353	0.833	1.267E-23	446	0.160	0.390	7d10A.pdb.gz
19	PDB:7cmhB	0.318	0.692	2.318E-9	458	0.086	0.203	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
20	PDB:5j4nA	0.304	0.688	3.552E-8	437	0.068	0.169	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LGD3	1179	1077	0.559	0.564	A0A0B4LGD3_DROME Kazachoc, isoform G OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
2	A0A0B4LHE0	1187	1066	0.565	0.575	A0A0B4LHE0_DROME Kazachoc, isoform F OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
3	B4DF30	2220	1079	0.993	0.998	B4DF30_HUMAN cDNA FLJ60065, highly similar to Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 PE=2 SV=1
4	C0KDV0	917	1061	0.467	0.478	C0KDV0_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
5	G5EEC9	918	1079	0.467	0.470	G5EEC9_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
6	H2KZC2	917	1102	0.467	0.460	H2KZC2_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=1
7	H2KZC3	917	1129	0.467	0.449	H2KZC3_CAEEL K+/Cl-Cotransporter OS=Caenorhabditis elegans OX=6239 GN=kcc-2 PE=1 SV=2
8	Q09573	743	1070	0.387	0.393	KCC3_CAEEL Potassium/chloride cotransporter 3 OS=Caenorhabditis elegans OX=6239 GN=kcc-3 PE=1 SV=2
9	Q28677	2194	1085	0.972	0.972	S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus OX=9986 GN=SLC12A4 PE=1 SV=1
10	Q5RK27	1519	1083	0.700	0.702	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
11	Q63633	1558	1139	0.705	0.672	S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus OX=10116 GN=Slc12a5 PE=1 SV=2
12	Q8MKK5	1184	1028	0.556	0.587	Q8MKK5_DROME GH09271p OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
13	Q8MLQ5	1191	1074	0.564	0.570	Q8MLQ5_DROME Kazachoc, isoform D OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=1
14	Q91V14	1554	1138	0.704	0.671	S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus OX=10090 GN=Slc12a5 PE=1 SV=2
15	Q924N4	1724	1150	0.760	0.717	S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus OX=10090 GN=Slc12a6 PE=1 SV=2
16	Q9H2X9	1552	1139	0.703	0.670	S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens OX=9606 GN=SLC12A5 PE=1 SV=3
17	Q9JIS8	2172	1085	0.962	0.962	S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus OX=10090 GN=Slc12a4 PE=1 SV=2
18	Q9UHW9	1728	1150	0.762	0.719	S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens OX=9606 GN=SLC12A6 PE=1 SV=2
19	Q9UP95	2246	1085	1.000	1.000	S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens OX=9606 GN=SLC12A4 PE=1 SV=2
20	Q9W1G5	1190	1059	0.560	0.574	Q9W1G5_DROME Kazachoc, isoform C OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	7.2e-61	217.9	Amino acid permease
2	PF13520 AA_permease_2	3e-11	54.5	Amino acid permease
3	PF03522 SLC12	3.5e-42	156.5	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000004890

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000023698	0.804	Solute carrier family 12 (potassium/chloride transporter), member 7
2	9593.ENSGGOP00000011999	0.698	Solute carrier family 25, member 30
3	9593.ENSGGOP00000022977	0.698	Actin-related protein 10 homolog (S. cerevisiae)
4	9593.ENSGGOP00000008092	0.686	Nescient helix loop helix 2
5	9593.ENSGGOP00000004119	0.685	Transcription elongation factor 1 homolog
6	9593.ENSGGOP00000011299	0.681	WNK lysine deficient protein kinase 3
7	9593.ENSGGOP00000004277	0.622	Serine threonine kinase 39
8	9593.ENSGGOP00000000774	0.621	Palmitoyltransferase
9	9593.ENSGGOP00000018090	0.611	Solute carrier family 24 (sodium/potassium/calcium exchanger), member 3
10	9593.ENSGGOP00000013544	0.609	Protein serine kinase H1
11	9593.ENSGGOP00000025387	0.608	Solute carrier family 12 (potassium/chloride transporter), member 5
12	9593.ENSGGOP00000008234	0.605	Exosome component 5
13	9593.ENSGGOP00000024945	0.586	Sodium channel protein
14	9593.ENSGGOP00000023804	0.580	Trafficking protein particle complex 9
15	9593.ENSGGOP00000007371	0.573	Neuropilin (NRP) and tolloid (TLL)-like 2
16	9593.ENSGGOP00000006330	0.560	WNK lysine deficient protein kinase 1
17	9593.ENSGGOP00000001744	0.546	Solute carrier family 22 (organic cation/carnitine transporter), member 16
18	9593.ENSGGOP00000003795	0.538	Radial spoke 3 homolog (Chlamydomonas)
19	9593.ENSGGOP00000006197	0.535	Oxidative stress responsive 1
20	9593.ENSGGOP00000012266	0.531	Solute carrier family 2 (facilitated glucose transporter), member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015379	0.999	potassium:chloride symporter activity
GO:0005488	0.986	binding
GO:0005515	0.981	protein binding
GO:0015267	0.713	channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0006811	0.966	monoatomic ion transport
GO:0065007	0.922	biological regulation
GO:0019725	0.865	cellular homeostasis
GO:0048878	0.849	chemical homeostasis
GO:0055082	0.754	intracellular chemical homeostasis
GO:0065008	0.630	regulation of biological quality
GO:0098655	0.589	monoatomic cation transmembrane transport
GO:0098662	0.586	inorganic cation transmembrane transport
GO:0006884	0.576	cell volume homeostasis
GO:0030001	0.552	metal ion transport
GO:0050801	0.449	monoatomic ion homeostasis
GO:0055080	0.405	monoatomic cation homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005737	0.974	cytoplasm
GO:0031090	0.403	organelle membrane
GO:0098588	0.305	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.999	chloride(in) = chloride(out)
RHEA:29463	0.999	K(+)(in) = K(+)(out)

[back to server]