StarFunc result for job id Q9UPA5

User Input

>input (1400 residues)
MGNEVSLEGGAGDGPLPPGGAGPGPGPGPGPGAGKPPSAPAGGGQLPAAGAARSTAVPPV
PGPGPGPGPGPGPGSTSRRLDPKEPLGNQRAASPTPKQASATTPGHESPRETRAQGPAGQ
EADGPRRTLQVDSRTQRSGRSPSVSPDRGSTPTSPYSVPQIAPLPSSTLCPICKTSDLTS
TPSQPNFNTCTQCHNKVCNQCGFNPNPHLTQVKEWLCLNCQMQRALGMDMTTAPRSKSQQ
QLHSPALSPAHSPAKQPLGKPDQERSRGPGGPQPGSRQAETARATSVPGPAQAAAPPEVG
RVSPQPPQPTKPSTAEPRPPAGEAPAKSATAVPAGLGATEQTQEGLTGKLFGLGASLLTQ
ASTLMSVQPEADTQGQPAPSKGTPKIVFNDASKEAGPKPLGSGPGPGPAPGAKTEPGARM
GPGSGPGALPKTGGTTSPKHGRAEHQAASKAAAKPKTMPKERAICPLCQAELNVGSKSPA
NYNTCTTCRLQVCNLCGFNPTPHLVEKTEWLCLNCQTKRLLEGSLGEPTPLPPPTSQQPP
VGAPHRASGTSPLKQKGPQGLGQPSGPLPAKASPLSTKASPLPSKASPQAKPLRASEPSK
TPSSVQEKKTRVPTKAEPMPKPPPETTPTPATPKVKSGVRRAEPATPVVKAVPEAPKGGE
AEDLVGKPYSQDASRSPQSLSDTGYSSDGISSSQSEITGVVQQEVEQLDSAGVTGPHPPS
PSEIHKVGSSMRPLLQAQGLAPSERSKPLSSGTGEEQKQRPHSLSITPEAFDSDEELEDI
LEEDEDSAEWRRRREQQDTAESSDDFGSQLRHDYVEDSSEGGLSPLPPQPPARAAELTDE
DFMRRQILEMSAEEDNLEEDDTATSGRGLAKHGTQKGGPRPRPEPSQEPAALPKRRLPHN
ATTGYEELLPEGGSAEATDGSGTLQGGLRRFKTIELNSTGSYGHELDLGQGPDPSLDREP
ELEMESLTGSPEDRSRGEHSSTLPASTPSYTSGTSPTSLSSLEEDSDSSPSRRQRLEEAK
QQRKARHRSHGPLLPTIEDSSEEEELREEEELLREQEKMREVEQQRIRSTARKTRRDKEE
LRAQRRRERSKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSPSLDSEAEALD
GGPSRLYKSGSEYNLPTFMSLYSPTETPSGSSTTPSSGRPLKSAEEAYEEMMRKAELLQR
QQGQAAGARGPHGGPSQPTGPRGLGSFEYQDTTDREYGQAAQPAAEGTPASLGAAVYEEI
LQTSQSIVRMRQASSRDLAFAEDKKKEKQFLNAESAYMDPMKQNGGPLTPGTSPTQLAAP
VSFSTPTSSDSSGGRVIPDVRVTQHFAKETQDPLKLHSSPASPSSASKEIGMPFSQGPGT
PATTAVAPCPAGLPRGYMTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7YSI9	0.051	0.046	3.268E-7	1654	0.135	0.114	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
2	AFDB:D3Z8E6	0.042	0.038	1.068E-5	1604	0.123	0.107	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
3	AFDB:X2JEM2	0.043	0.029	1.142E-5	2326	0.144	0.087	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
4	AFDB:Q9VED3	0.056	0.065	1.397E-5	1186	0.111	0.131	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
5	AFDB:Q09MP3	0.047	0.055	1.597E-5	1159	0.098	0.118	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
6	AFDB:O44498	0.043	0.038	4.084E-5	1623	0.164	0.141	O44498.pdb.gz	SET9_CAEEL Histone-lysine N-methyltransferase set-9 OS=Caenorhabditis elegans OX=6239 GN=set-9 PE=1 SV=2
7	AFDB:Q86V38	0.054	0.062	4.671E-5	1191	0.150	0.176	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
8	AFDB:Q8IRB5	0.037	0.036	6.531E-5	1465	0.114	0.109	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
9	AFDB:H2KYH3	0.044	0.029	9.133E-5	2476	0.159	0.090	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
10	AFDB:Q9VFH4	0.040	0.044	1.194E-4	1200	0.144	0.168	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
11	PDB:1b8tA	0.030	0.161	1.266	192	0.016	0.115	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
12	PDB:7egb3	0.027	0.135	1.771	263	0.007	0.038	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:5tteB	0.029	0.087	2.025	442	0.008	0.025	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
14	PDB:7b5lH	0.022	0.059	2.165	423	0.008	0.026	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
15	PDB:2m1sA	0.022	0.185	3.702	99	0.019	0.263	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
16	PDB:7odr0	0.021	0.206	7.741	110	0.009	0.118	7odr0.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
17	PDB:4btsA9	0.024	0.144	8.278	93	0.006	0.097	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
18	PDB:3j6bW	0.020	0.217	8.852	112	0.006	0.080	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88737	0.0	2061	3942	0.837	0.297	BSN_MOUSE Protein bassoon OS=Mus musculus OX=10090 GN=Bsn PE=1 SV=4
2	O88778	0.0	2060	3938	0.832	0.296	BSN_RAT Protein bassoon OS=Rattus norvegicus OX=10116 GN=Bsn PE=1 SV=3
3	Q9UPA5	0.0	2763	3926	1.000	0.357	BSN_HUMAN Protein bassoon OS=Homo sapiens OX=9606 GN=BSN PE=1 SV=4
4	Q9JKS6	1.48e-109	387	5085	0.285	0.078	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
5	Q9QYX7	1.16e-80	297	5068	0.219	0.060	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
6	Q9Y6V0	7.24e-75	278	5142	0.179	0.049	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
7	Q9Y2J0	0.15	38.9	694	0.026	0.053	RP3A_HUMAN Rabphilin-3A OS=Homo sapiens OX=9606 GN=RPH3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02318 FYVE_2	0.028	26.0	FYVE-type zinc finger
2	PF01485 IBR	2.1e+02	13.4	IBR domain, a half RING-finger domain
3	PF05715 zf-piccolo	4.8e-51	182.2	Piccolo Zn-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311825	0.986	C-terminal-binding protein 2
2	9606.ENSP00000468263	0.984	ELKS/Rab6-interacting/CAST family member 1
3	9606.ENSP00000429562	0.961	Protein unc-13 homolog A
4	9606.ENSP00000428417	0.956	Regulating synaptic membrane exocytosis protein 1
5	9606.ENSP00000367756	0.953	Protein unc-13 homolog B
6	9606.ENSP00000358072	0.940	Autophagy protein 5
7	9606.ENSP00000290921	0.938	C-terminal-binding protein 1
8	9606.ENSP00000288221	0.887	ERC protein 2
9	9606.ENSP00000382428	0.871	Disks large homolog 4
10	9606.ENSP00000367595	0.830	Tumor protein p63 regulated 1 like
11	9606.ENSP00000221485	0.820	Vesicular glutamate transporter 1
12	9606.ENSP00000264255	0.801	Thioredoxin domain-containing protein 9
13	9606.ENSP00000295987	0.798	Synapsin-1
14	9606.ENSP00000360608	0.798	Glutamate receptor ionotropic, NMDA 1
15	9606.ENSP00000263233	0.791	Synaptophysin
16	9606.ENSP00000334382	0.779	Homer protein homolog 1
17	9606.ENSP00000407118	0.772	Syntabulin
18	9606.ENSP00000222256	0.769	Ras-related protein Rab-3A
19	9606.ENSP00000335614	0.767	Liprin-alpha-3
20	9606.ENSP00000217420	0.742	Vesicular inhibitory amino acid transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007154	0.991	cell communication
GO:0023052	0.947	signaling
GO:0065007	0.924	biological regulation
GO:0051641	0.676	cellular localization
GO:0050789	0.565	regulation of biological process
GO:0006810	0.418	transport
GO:0050794	0.357	regulation of cellular process
GO:0051649	0.339	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0098831	0.993	presynaptic active zone cytoplasmic component
GO:0043229	0.990	intracellular organelle
GO:0043227	0.987	membrane-bounded organelle
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0016020	0.976	membrane
GO:0043232	0.903	intracellular non-membrane-bounded organelle
GO:0005886	0.901	plasma membrane
GO:0005856	0.877	cytoskeleton
GO:0005634	0.858	nucleus
GO:0030863	0.826	cortical cytoskeleton
GO:0099569	0.823	presynaptic cytoskeleton
GO:0048788	0.809	cytoskeleton of presynaptic active zone
GO:0012505	0.704	endomembrane system
GO:0036477	0.589	somatodendritic compartment
GO:0042995	0.540	cell projection
GO:0030424	0.516	axon
GO:0098978	0.483	glutamatergic synapse
GO:0005829	0.433	cytosol
GO:0098888	0.382	extrinsic component of presynaptic membrane
GO:0031982	0.377	vesicle
GO:0031410	0.358	cytoplasmic vesicle
GO:0098984	0.306	neuron to neuron synapse
GO:0098794	0.301	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]