StarFunc result for job id Q9UPG8

User Input

>input (496 residues)
MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL
PQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH
DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR
RVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKK
SHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGTKAFPGMLPMGMYGA
HIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVD
SFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFT
SGLSSTTLPRFHQAFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZQG6	0.422	0.414	2.003E-75	506	0.986	0.966	Q6ZQG6.pdb.gz	Q6ZQG6_MOUSE MKIAA0198 protein (Fragment) OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
2	AFDB:A0A024R7Z0	0.348	0.345	8.897E-41	500	0.508	0.504	A0A024R7Z0.pdb.gz
3	AFDB:Q9UM63	0.379	0.404	5.288E-34	463	0.429	0.460	Q9UM63.pdb.gz	PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens OX=9606 GN=PLAGL1 PE=1 SV=2
4	AFDB:Q9JLQ4	0.232	0.173	9.932E-27	704	0.383	0.270	Q9JLQ4.pdb.gz	Q9JLQ4_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
5	AFDB:P57071	0.241	0.094	1.188E-16	1507	0.210	0.069	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
6	AFDB:Q2EI20	0.233	0.154	1.974E-13	855	0.165	0.096	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
7	AFDB:A2A5K6	0.176	0.081	2.391E-13	1337	0.228	0.085	A2A5K6.pdb.gz	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1
8	AFDB:A2A935	0.277	0.125	5.489E-13	1275	0.185	0.072	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
9	AFDB:Q13127	0.224	0.120	7.088E-13	1097	0.169	0.077	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
10	AFDB:Q9VQU9	0.218	0.153	9.153E-13	744	0.228	0.152	Q9VQU9.pdb.gz	BOWEL_DROME Protein bowel OS=Drosophila melanogaster OX=7227 GN=bowl PE=1 SV=1
11	PDB:3w5kB	0.097	0.281	1.681E-3	110	0.056	0.255	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6htsR	0.045	0.232	1.217	72	0.034	0.236	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
13	PDB:4wlwA	0.070	0.215	1.297	130	0.034	0.131	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
14	PDB:5gm6a	0.039	0.119	1.383	123	0.032	0.130	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7oniH	0.056	0.066	1.785	380	0.062	0.082	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:1e7dA	0.078	0.174	2.306	157	0.038	0.121	1e7dA.pdb.gz	Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
17	PDB:7uhyA	0.051	0.036	2.306	771	0.040	0.026	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:7c4jB	0.073	0.084	2.458	395	0.056	0.071	7c4jB.pdb.gz
19	PDB:7o4iW	0.047	0.064	2.458	312	0.040	0.064	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
20	PDB:4fjcE	0.048	0.051	2.793	434	0.040	0.046	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UZI7	0.0	1004	496	0.984	0.984	Q3UZI7_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
2	Q6ZQG6	0.0	1008	506	0.986	0.966	Q6ZQG6_MOUSE MKIAA0198 protein (Fragment) OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
3	Q925T4	0.0	1008	496	0.986	0.986	Q925T4_MOUSE PLAGL2 OS=Mus musculus OX=10090 GN=Plagl2 PE=1 SV=1
4	Q9QZJ1	0.0	823	408	0.810	0.985	Q9QZJ1_MOUSE Pleomorphic adenoma gene like 2 OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
5	Q9UPG8	0.0	1021	496	1.000	1.000	PLAL2_HUMAN Zinc finger protein PLAGL2 OS=Homo sapiens OX=9606 GN=PLAGL2 PE=1 SV=1
6	Q6DJT9	3.21e-157	458	500	0.516	0.512	PLAG1_HUMAN Zinc finger protein PLAG1 OS=Homo sapiens OX=9606 GN=PLAG1 PE=1 SV=1
7	Q9QYE0	8.61e-154	449	499	0.508	0.505	PLAG1_MOUSE Zinc finger protein PLAG1 OS=Mus musculus OX=10090 GN=Plag1 PE=2 SV=2
8	Q8CFT9	3.00e-115	339	198	0.327	0.818	Q8CFT9_MOUSE Plagl2 protein OS=Mus musculus OX=10090 GN=Plagl2 PE=2 SV=1
9	Q9UM63	6.03e-106	325	463	0.427	0.458	PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens OX=9606 GN=PLAGL1 PE=1 SV=2
10	Q9EPT3	4.04e-89	288	675	0.278	0.204	Q9EPT3_MOUSE Lost on transformation protein 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
11	O35745	4.97e-89	288	667	0.278	0.207	O35745_MOUSE Zinc finger protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
12	B7ZP38	6.39e-89	288	678	0.278	0.204	B7ZP38_MOUSE Plagl1 protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
13	Q3UQW2	6.39e-89	288	678	0.278	0.204	Q3UQW2_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
14	Q3UQR2	6.46e-89	288	678	0.278	0.204	Q3UQR2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
15	Q9JLQ4	1.16e-88	288	704	0.288	0.203	Q9JLQ4_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
16	A0A0A6YWE3	5.36e-43	150	121	0.137	0.562	A0A0A6YWE3_MOUSE Pleiomorphic adenoma gene-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Plagl1 PE=4 SV=1
17	B0QZX4	3.94e-40	142	117	0.131	0.556	B0QZX4_MOUSE Pleiomorphic adenoma gene-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Plagl1 PE=4 SV=1
18	M9PD94	8.31e-28	120	907	0.131	0.072	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
19	Q9H5H4	2.99e-26	114	540	0.139	0.128	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
20	Q13105	4.19e-26	114	803	0.143	0.088	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16076 Acyltransf_C	60	15.0	Acyltransferase C-terminus
2	PF00130 C1_1	6e+02	11.7	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF19234 DUF5887	3.9e+02	12.4	Family of unknown function (DUF5887)
4	PF00096 zf-C2H2	4e-14	63.3	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	1.1e-16	71.0	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.025	25.9	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	15	17.2	Zinc-finger double-stranded RNA-binding
8	PF10276 zf-CHCC	4e+02	12.5	Zinc-finger domain
9	PF05605 zf-Di19	1.1e+02	14.5	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	2.3e-15	67.4	Zinc-finger double domain
11	PF12874 zf-met	85	15.0	Zinc-finger of C2H2 type
12	PF12907 zf-met2	3.1e+02	12.9	Zinc-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381104	0.665	Transmembrane 9 superfamily member 4
2	9606.ENSP00000364864	0.655	Kinesin-like protein KIF3B
3	9606.ENSP00000364902	0.650	GDP-fucose protein O-fucosyltransferase 1
4	9606.ENSP00000299440	0.608	V(D)J recombination-activating protein 1
5	9606.ENSP00000321239	0.598	RING finger and CHY zinc finger domain-containing protein 1
6	9606.ENSP00000297146	0.584	Probable G-protein coupled receptor 85
7	9606.ENSP00000355354	0.573	Protein SOX-15
8	9606.ENSP00000252998	0.571	RBBP8 N-terminal-like protein
9	9606.ENSP00000294489	0.551	Podoplanin
10	9606.ENSP00000479101	0.541	Ectoderm-neural cortex protein 1
11	9606.ENSP00000367203	0.530	Lysine-specific demethylase 6A
12	9606.ENSP00000279101	0.526	CDK5 and ABL1 enzyme substrate 2
13	9606.ENSP00000374205	0.522	T-box brain protein 1
14	9606.ENSP00000483523	0.514	Nucleolar protein 4 like
15	9606.ENSP00000353132	0.511	Diencephalon/mesencephalon homeobox protein 1
16	9606.ENSP00000361048	0.509	Leucine rich adaptor protein 1
17	9606.ENSP00000257910	0.501	Tetraspanin-31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.978	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0031323	0.942	regulation of cellular metabolic process
GO:0080090	0.934	regulation of primary metabolic process
GO:0010468	0.931	regulation of gene expression
GO:0051171	0.925	regulation of nitrogen compound metabolic process
GO:0097006	0.921	regulation of plasma lipoprotein particle levels
GO:0071825	0.920	protein-lipid complex subunit organization
GO:0032501	0.917	multicellular organismal process
GO:2001233	0.902	regulation of apoptotic signaling pathway
GO:2001242	0.890	regulation of intrinsic apoptotic signaling pathway
GO:0032502	0.889	developmental process
GO:0010556	0.887	regulation of macromolecule biosynthetic process
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0051252	0.876	regulation of RNA metabolic process
GO:0071704	0.870	organic substance metabolic process
GO:2001235	0.870	positive regulation of apoptotic signaling pathway
GO:0006355	0.863	regulation of DNA-templated transcription
GO:0044238	0.843	primary metabolic process
GO:0048856	0.835	anatomical structure development
GO:0045944	0.730	positive regulation of transcription by RNA polymerase II
GO:2001244	0.630	positive regulation of intrinsic apoptotic signaling pathway
GO:0007275	0.624	multicellular organism development
GO:0071827	0.506	plasma lipoprotein particle organization
GO:0022607	0.435	cellular component assembly
GO:0065003	0.389	protein-containing complex assembly
GO:0006629	0.367	lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.579	nuclear lumen
GO:0005654	0.477	nucleoplasm
GO:0016020	0.346	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]