StarFunc result for job id Q9UPI3

User Input

>input (526 residues)
MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQ
PSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSFQWIQYGSINNIFMHFYGVSA
FAIDWLSMCYMLTYIPLLLPVAWLLEKFGLRTIALTGSALNCLGAWVKLGSLKPHLFPVT
VVGQLICSVAQVFILGMPSRIASVWFGANEVSTACSVAVFGNQLGIAIGFLVPPVLVPNI
EDRDELAYHISIMFYIIGGVATLLLILVIIVFKEKPKYPPSRAQSLSYALTSPDASYLGS
IARLFKNLNFVLLVITYGLNAGAFYALSTLLNRMVIWHYPGEEVNAGRIGLTIVIAGMLG
AVISGIWLDRSKTYKETTLVVYIMTLVGMVVYTFTLNLGHLWVVFITAGTMGFFMTGYLP
LGFEFAVELTYPESEGISSGLLNISAQVFGIIFTISQGQIIDNYGTKPGNIFLCVFLTLG
AALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPI3	1.000	1.000	6.319E-65	526	1.000	1.000	Q9UPI3.pdb.gz	FLVC2_HUMAN Heme transporter FLVCR2 OS=Homo sapiens OX=9606 GN=FLVCR2 PE=1 SV=1
2	AFDB:Q9Y5Y0	0.783	0.743	4.798E-42	555	0.538	0.510	Q9Y5Y0.pdb.gz	FLVC1_HUMAN Heme transporter FLVCR1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1
3	AFDB:Q5RGT2	0.814	0.812	2.707E-41	527	0.519	0.518	Q5RGT2.pdb.gz	Q5RGT2_DANRE FLVCR heme transporter 1 OS=Danio rerio OX=7955 GN=si:ch211-147d7.6 PE=4 SV=1
4	AFDB:B2RXV4	0.768	0.723	3.641E-39	560	0.496	0.466	B2RXV4.pdb.gz	FLVC1_MOUSE Heme transporter FLVCR1 OS=Mus musculus OX=10090 GN=Flvcr1 PE=2 SV=1
5	AFDB:Q17675	0.731	0.837	3.065E-21	456	0.209	0.241	Q17675.pdb.gz	Q17675_CAEEL MFS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C05G5.1 PE=1 SV=1
6	AFDB:Q6UXD7	0.733	0.691	1.592E-20	560	0.203	0.191	Q6UXD7.pdb.gz	S49A3_HUMAN Solute carrier family 49 member A3 OS=Homo sapiens OX=9606 GN=SLC49A3 PE=1 SV=1
7	AFDB:Q38BR2	0.741	0.716	2.515E-19	545	0.198	0.191	Q38BR2.pdb.gz	Q38BR2_TRYB2 MFS transporter OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4090 PE=4 SV=1
8	AFDB:Q96SL1	0.710	0.777	7.370E-18	478	0.202	0.222	Q96SL1.pdb.gz	DIRC2_HUMAN Solute carrier family 49 member 4 OS=Homo sapiens OX=9606 GN=SLC49A4 PE=1 SV=1
9	AFDB:Q66GI9	0.661	0.653	1.233E-12	533	0.141	0.139	Q66GI9.pdb.gz	ANTR4_ARATH Probable anion transporter 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR4 PE=2 SV=1
10	AFDB:Q8GX78	0.597	0.582	1.339E-12	541	0.156	0.152	Q8GX78.pdb.gz	ANTR2_ARATH Ascorbate transporter, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PHT4;4 PE=1 SV=1
11	PDB:4iu8B	0.631	0.764	1.929E-8	427	0.120	0.148	4iu8B.pdb.gz	Structure and mechanism of a nitrate transporter.
12	PDB:6thaA	0.595	0.687	2.182E-8	448	0.144	0.170	6thaA.pdb.gz
13	PDB:3o7qA	0.571	0.699	3.295E-8	414	0.118	0.150	3o7qA.pdb.gz
14	PDB:6oopA	0.609	0.797	3.728E-8	392	0.112	0.151	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
15	PDB:6kkkA	0.611	0.824	6.916E-8	381	0.112	0.155	6kkkA.pdb.gz
16	PDB:1pw4A	0.599	0.712	7.826E-8	434	0.124	0.150	1pw4A.pdb.gz
17	PDB:4u4tA	0.599	0.698	1.513E-7	444	0.122	0.144	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
18	PDB:7yr5A	0.621	0.831	1.643E-7	385	0.118	0.161	7yr5A.pdb.gz
19	PDB:7wsmA	0.591	0.662	3.175E-7	464	0.097	0.110	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
20	PDB:7bp3A	0.521	0.675	3.901E-7	394	0.122	0.162	7bp3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5RGT2	0.0	539	527	0.504	0.503	Q5RGT2_DANRE FLVCR heme transporter 1 OS=Danio rerio OX=7955 GN=si:ch211-147d7.6 PE=4 SV=1
2	Q9UPI3	0.0	1070	526	1.000	1.000	FLVC2_HUMAN Heme transporter FLVCR2 OS=Homo sapiens OX=9606 GN=FLVCR2 PE=1 SV=1
3	Q9Y5Y0	0.0	562	555	0.540	0.512	FLVC1_HUMAN Heme transporter FLVCR1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1
4	B2RXV4	4.57e-178	514	560	0.473	0.445	FLVC1_MOUSE Heme transporter FLVCR1 OS=Mus musculus OX=10090 GN=Flvcr1 PE=2 SV=1
5	Q17675	1.41e-35	140	456	0.207	0.239	Q17675_CAEEL MFS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C05G5.1 PE=1 SV=1
6	Q6UXD7	4.04e-32	132	560	0.196	0.184	S49A3_HUMAN Solute carrier family 49 member A3 OS=Homo sapiens OX=9606 GN=SLC49A3 PE=1 SV=1
7	Q38BR2	6.77e-22	101	545	0.217	0.209	Q38BR2_TRYB2 MFS transporter OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4090 PE=4 SV=1
8	Q96SL1	2.29e-18	90.1	478	0.194	0.213	DIRC2_HUMAN Solute carrier family 49 member 4 OS=Homo sapiens OX=9606 GN=SLC49A4 PE=1 SV=1
9	Q46916	5.97e-05	48.1	450	0.177	0.207	GUDP_ECOLI Probable galactarate/D-glucarate transporter GudP OS=Escherichia coli (strain K12) OX=83333 GN=gudP PE=1 SV=1
10	P0AA80	0.065	38.1	444	0.169	0.200	GARP_ECOLI Probable galactarate/D-glucarate transporter GarP OS=Escherichia coli (strain K12) OX=83333 GN=garP PE=1 SV=1
11	Q66GI9	0.11	37.7	533	0.137	0.135	ANTR4_ARATH Probable anion transporter 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ANTR4 PE=2 SV=1
12	Q9VML7	0.23	34.7	116	0.036	0.164	Q9VML7_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9029 PE=1 SV=1
13	Q9FKV1	0.29	36.2	432	0.059	0.072	ANTR5_ARATH Probable anion transporter 5 OS=Arabidopsis thaliana OX=3702 GN=ANTR5 PE=2 SV=1
14	Q4WXC4	0.69	35.0	430	0.044	0.053	Q4WXC4_ASPFU Cell surface protein, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G08990 PE=4 SV=1
15	A7E2V4	0.81	35.0	1837	0.032	0.009	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
16	M9NDL9	2.3	33.5	1988	0.040	0.011	M9NDL9_DROME Grunge, isoform F OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
17	M9PES2	2.3	33.5	1983	0.040	0.011	M9PES2_DROME Grunge, isoform I OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
18	Q7KUA8	2.3	33.5	1985	0.040	0.011	Q7KUA8_DROME Grunge, isoform D OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
19	Q86BH2	2.3	33.5	1988	0.040	0.011	Q86BH2_DROME Grunge, isoform C OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
20	Q8IQA6	2.3	33.5	1966	0.040	0.011	Q8IQA6_DROME Grunge, isoform A OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1e-23	95.5	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480703	0.777	Proton-coupled folate transporter
2	9606.ENSP00000356978	0.699	Protoporphyrinogen oxidase
3	9606.ENSP00000366641	0.686	Solute carrier family 2, facilitated glucose transporter member 5
4	9606.ENSP00000265983	0.681	Hemopexin
5	9606.ENSP00000264193	0.657	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
6	9606.ENSP00000219150	0.645	Coronin-1A
7	9606.ENSP00000337224	0.645	Lecithin retinol acyltransferase
8	9606.ENSP00000287936	0.627	3-hydroxy-3-methylglutaryl-coenzyme A reductase
9	9606.ENSP00000352779	0.619	Zinc transporter ZIP14
10	9606.ENSP00000217402	0.609	Charged multivesicular body protein 4b
11	9606.ENSP00000356814	0.608	DDB1- and CUL4-associated factor 6
12	9606.ENSP00000238936	0.602	Transmembrane protein 180
13	9606.ENSP00000372326	0.598	Ferrochelatase, mitochondrial
14	9606.ENSP00000355637	0.595	ATP-binding cassette sub-family B member 10, mitochondrial
15	9606.ENSP00000347583	0.589	Major facilitator superfamily domain containing 12
16	9606.ENSP00000415998	0.582	Heme transporter HRG1
17	9606.ENSP00000223215	0.578	Mesoderm-specific transcript homolog protein
18	9606.ENSP00000216122	0.571	DNA replication licensing factor MCM5
19	9606.ENSP00000258436	0.566	Major facilitator superfamily domain containing 9
20	9606.ENSP00000464932	0.559	UNC93-like protein MFSD11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015232	1.000	heme transmembrane transporter activity
GO:0020037	0.996	heme binding
GO:0005515	0.954	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0032501	0.985	multicellular organismal process
GO:0032502	0.952	developmental process
GO:0008152	0.904	metabolic process
GO:0044237	0.769	cellular metabolic process
GO:0071704	0.738	organic substance metabolic process
GO:0006807	0.721	nitrogen compound metabolic process
GO:0048856	0.662	anatomical structure development
GO:1901564	0.652	organonitrogen compound metabolic process
GO:0042440	0.565	pigment metabolic process
GO:1901360	0.530	organic cyclic compound metabolic process
GO:0006725	0.514	cellular aromatic compound metabolic process
GO:0006810	0.509	transport
GO:0046483	0.506	heterocycle metabolic process
GO:0042592	0.470	homeostatic process
GO:0006778	0.442	porphyrin-containing compound metabolic process
GO:0042168	0.406	heme metabolic process
GO:0002376	0.375	immune system process
GO:0065007	0.345	biological regulation
GO:0048869	0.322	cellular developmental process
GO:0050789	0.307	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0005622	0.995	intracellular anatomical structure
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005737	0.988	cytoplasm
GO:0005739	0.777	mitochondrion
GO:0031090	0.742	organelle membrane
GO:0005740	0.724	mitochondrial envelope
GO:0031966	0.544	mitochondrial membrane
GO:0019866	0.347	organelle inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]