StarFunc result for job id Q9UPM8

User Input

>input (1137 residues)
MSDIVEKTLTALPGLFLQNQPGGGPAAAKASFSSRLGSLVRGITALTSKHEEEKLIQQEL
SSLKATVSAPTTTLKMMKECMVRLIYCEMLGYDASFGYIHAIKLAQQGNLLEKRVGYLAV
SLFLHESHELLLLLVNTVVKDLQSTNLVEVCMALTVVSQIFPCEMIPAVLPLIEDKLQHS
KEIVRRKAVLALYKFHLIAPNQVQHIHIKFRKALCDRDVGVMAASLHIYLRMIKENSSGY
KDLTGSFVTILKQVVGGKLPVEFNYHSVPAPWLQIQLLRILGLLGKDDQRTSELMYDVLD
ESLRRAELNHNVTYAILFECVHTVYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKAL
TYVIQQDPTLALQHQMTIIECLDHPDPIIKRETLELLYRITNAQNITVIVQKMLEYLHQS
KEEYVIVNLVGKIAELAEKYAPDNAWFIQTMNAVFSVGGDVMHPDIPNNFLRLLAEGFDD
ETEDQQLRLYAVQSYLTLLDMENVFYPQRFLQVMSWVLGEYSYLLDKETPEEVIAKLYKL
LMNDSVSSETKAWLIAAVTKLTSQAHSSNTVERLIHEFTISLDTCMRQHAFELKHLHENV
ELMKSLLPVDRSCEDLVVDASLSFLDGFVAEGLSQGAAPYKPPHQRQEEKLSQEKVLNFE
PYGLSFSSSGFTGRQSPAGISLGSDVSGNSAETGLKETNSLKLEGIKKLWGKEGYLPKKE
SKTGDESGALPVPQESIMENVDQAITKKDQSQVLTQSKEEKEKQLLASSLFVGLGSESTI
NLLGKADTVSHKFRRKSKVKEAKSGETTSTHNMTCSSFSSLSNVAYEDDYYSNTLHDTGD
KELKKFSLTSELLDSESLTELPLVEKFSYCSLSTPSLFANNNMEIFHPPQSTAASVAKES
SLASSFLEETTEYIHSNAMEVCNNETISVSSYKIWKDDCLLMVWSVTNKSGLELKSADLE
IFPAENFKVTEQPGCCLPVMEAESTKSFQYSVQIEKPFTEGNLTGFISYHMMDTHSAQLE
FSVNLSLLDFIRPLKISSDDFGKLWLSFANDVKQNVKMSESQAALPSALKTLQQKLRLHI
IEIIGNEGLLACQLLPSIPCLLHCRVHADVLALWFRSSCSTLPDYLLYQCQKVMEGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80V94	0.865	0.876	0.000	1122	0.805	0.816	Q80V94.pdb.gz	AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus OX=10090 GN=Ap4e1 PE=1 SV=3
2	AFDB:Q9UPM8	1.000	1.000	0.000	1137	1.000	1.000	Q9UPM8.pdb.gz	AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens OX=9606 GN=AP4E1 PE=1 SV=2
3	AFDB:Q583N8	0.390	0.425	1.322E-47	1025	0.222	0.246	Q583N8.pdb.gz	Q583N8_TRYB2 AP-4 complex subunit epsilon OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.640 PE=3 SV=1
4	AFDB:Q8L7A9	0.519	0.623	1.630E-45	938	0.275	0.334	Q8L7A9.pdb.gz	AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=At1g31730 PE=1 SV=1
5	AFDB:O14617	0.387	0.383	5.634E-35	1153	0.192	0.189	O14617.pdb.gz	AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1
6	AFDB:Q84K16	0.342	0.418	2.105E-33	876	0.177	0.229	Q84K16.pdb.gz	AP1G1_ARATH AP-1 complex subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=GAMMA-ADR PE=1 SV=1
7	AFDB:Q9UU81	0.474	0.610	9.330E-30	865	0.163	0.214	Q9UU81.pdb.gz	AP1G1_SCHPO AP-1 complex subunit gamma-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl4 PE=3 SV=1
8	AFDB:B3KXW5	0.470	0.624	1.047E-29	845	0.174	0.234	B3KXW5.pdb.gz	B3KXW5_HUMAN AP-1 complex subunit gamma OS=Homo sapiens OX=9606 PE=2 SV=1
9	AFDB:O75843	0.328	0.438	1.047E-29	785	0.165	0.239	O75843.pdb.gz	AP1G2_HUMAN AP-1 complex subunit gamma-like 2 OS=Homo sapiens OX=9606 GN=AP1G2 PE=1 SV=1
10	AFDB:B0R024	0.337	0.444	9.053E-29	794	0.157	0.225	B0R024.pdb.gz	B0R024_DANRE AP-1 complex subunit gamma OS=Danio rerio OX=7955 GN=fc07e03 PE=1 SV=1
11	PDB:5a1uE	0.358	0.473	2.137E-14	824	0.115	0.159	5a1uE.pdb.gz
12	PDB:7p3xA	0.298	0.493	2.762E-11	576	0.108	0.214	7p3xA.pdb.gz
13	PDB:5nzrG	0.277	0.374	1.073E-9	798	0.117	0.167	5nzrG.pdb.gz
14	PDB:7p3xB	0.301	0.479	1.530E-8	621	0.085	0.156	7p3xB.pdb.gz
15	PDB:5a1uG	0.163	0.210	2.749E-7	813	0.113	0.157	5a1uG.pdb.gz
16	PDB:6yafB	0.291	0.498	1.143E-6	579	0.098	0.192	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
17	PDB:1b3uA	0.211	0.341	1.886E-6	588	0.061	0.117	1b3uA.pdb.gz
18	PDB:7rroH7	0.207	0.350	3.493E-6	580	0.066	0.129	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:4jlqA	0.249	0.307	4.402E-6	840	0.079	0.107	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
20	PDB:3w3uA	0.257	0.277	4.941E-6	1030	0.076	0.083	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80V94	0.0	1843	1122	0.805	0.816	AP4E1_MOUSE AP-4 complex subunit epsilon-1 OS=Mus musculus OX=10090 GN=Ap4e1 PE=1 SV=3
2	Q9UPM8	0.0	2343	1137	1.000	1.000	AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens OX=9606 GN=AP4E1 PE=1 SV=2
3	Q8L7A9	4.25e-168	523	938	0.259	0.314	AP4E_ARATH AP-4 complex subunit epsilon OS=Arabidopsis thaliana OX=3702 GN=At1g31730 PE=1 SV=1
4	Q583N8	1.20e-91	319	1025	0.167	0.185	Q583N8_TRYB2 AP-4 complex subunit epsilon OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.640 PE=3 SV=1
5	Q7ZUU8	3.48e-65	239	819	0.150	0.208	Q7ZUU8_DANRE AP-1 complex subunit gamma OS=Danio rerio OX=7955 GN=adtg PE=1 SV=1
6	Q8I8U2	1.41e-63	235	895	0.144	0.183	AP1G_DICDI AP-1 complex subunit gamma OS=Dictyostelium discoideum OX=44689 GN=ap1g1 PE=1 SV=1
7	P22892	1.49e-63	234	822	0.148	0.204	AP1G1_MOUSE AP-1 complex subunit gamma-1 OS=Mus musculus OX=10090 GN=Ap1g1 PE=1 SV=3
8	O43747	1.56e-63	234	822	0.148	0.204	AP1G1_HUMAN AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5
9	B3KXW5	2.69e-63	234	845	0.148	0.199	B3KXW5_HUMAN AP-1 complex subunit gamma OS=Homo sapiens OX=9606 PE=2 SV=1
10	B2RYN6	2.87e-63	233	822	0.147	0.203	B2RYN6_RAT AP-1 complex subunit gamma OS=Rattus norvegicus OX=10116 GN=Ap1g1 PE=1 SV=1
11	A0A8I5Y697	1.04e-62	233	875	0.147	0.191	A0A8I5Y697_RAT AP-1 complex subunit gamma OS=Rattus norvegicus OX=10116 GN=Ap1g1 PE=1 SV=1
12	A0A140VJE7	4.80e-62	230	825	0.148	0.204	A0A140VJE7_HUMAN AP-1 complex subunit gamma OS=Homo sapiens OX=9606 PE=2 SV=1
13	A0A8I6ARE9	9.30e-62	229	825	0.147	0.202	A0A8I6ARE9_RAT AP-1 complex subunit gamma OS=Rattus norvegicus OX=10116 GN=Ap1g1 PE=1 SV=1
14	Q9W388	3.45e-60	226	963	0.139	0.164	Q9W388_DROME AP-1 complex subunit gamma OS=Drosophila melanogaster OX=7227 GN=AP-1gamma PE=1 SV=2
15	Q86B59	3.65e-60	226	969	0.137	0.161	Q86B59_DROME AP-1 complex subunit gamma OS=Drosophila melanogaster OX=7227 GN=AP-1gamma PE=1 SV=2
16	Q7KVR7	3.69e-60	226	976	0.139	0.162	Q7KVR7_DROME AP-1 complex subunit gamma OS=Drosophila melanogaster OX=7227 GN=AP-1gamma PE=1 SV=1
17	Q7KVR8	4.98e-60	226	982	0.137	0.159	Q7KVR8_DROME AP-1 complex subunit gamma OS=Drosophila melanogaster OX=7227 GN=AP-1gamma PE=1 SV=1
18	O88512	1.20e-57	216	791	0.139	0.200	AP1G2_MOUSE AP-1 complex subunit gamma-like 2 OS=Mus musculus OX=10090 GN=Ap1g2 PE=1 SV=2
19	A0A8I6AE72	3.48e-57	214	789	0.142	0.204	A0A8I6AE72_RAT AP-1 complex subunit gamma OS=Rattus norvegicus OX=10116 GN=Ap1g1 PE=1 SV=1
20	Q8LPL6	4.77e-55	211	1012	0.141	0.158	AP2A1_ARATH AP-2 complex subunit alpha-1 OS=Arabidopsis thaliana OX=3702 GN=ALPHA-ADR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	9.2e-83	290.2	Adaptin N terminal region
2	PF14807 AP4E_app_platf	2.8e-32	122.3	Adaptin AP4 complex epsilon appendage platform
3	PF12717 Cnd1	15	17.1	non-SMC mitotic condensation complex subunit 1
4	PF14806 Coatomer_b_Cpla	0.33	22.4	Coatomer beta subunit appendage platform
5	PF02985 HEAT	3e+02	13.1	HEAT repeat
6	PF13646 HEAT_2	73	15.2	HEAT repeats

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358582	0.999	AP-4 complex subunit beta-1
2	9606.ENSP00000216366	0.998	AP-4 complex subunit sigma-1
3	9606.ENSP00000352603	0.997	AP-4 complex subunit mu-1
4	9606.ENSP00000349437	0.981	Cation-independent mannose-6-phosphate receptor
5	9606.ENSP00000314499	0.970	Cyclin-G-associated kinase
6	9606.ENSP00000336666	0.970	AP-1 complex subunit sigma-1A
7	9606.ENSP00000255194	0.969	AP-3 complex subunit beta-1
8	9606.ENSP00000261558	0.967	AP-5 complex subunit mu-1
9	9606.ENSP00000292807	0.962	AP-2 complex subunit mu
10	9606.ENSP00000297562	0.961	AP-5 complex subunit zeta-1
11	9606.ENSP00000386443	0.958	Trans-Golgi network integral membrane protein 2
12	9606.ENSP00000482835	0.958	AP-2 complex subunit beta
13	9606.ENSP00000338777	0.954	AP-3 complex subunit sigma-2
14	9606.ENSP00000351926	0.951	AP-2 complex subunit alpha-1
15	9606.ENSP00000325369	0.947	AP-3 complex subunit sigma-1
16	9606.ENSP00000360108	0.945	Putative tyrosine-protein phosphatase auxilin
17	9606.ENSP00000263270	0.944	AP-2 complex subunit sigma
18	9606.ENSP00000327694	0.942	AP-2 complex subunit alpha-2
19	9606.ENSP00000417573	0.938	Protein YIPF6
20	9606.ENSP00000481750	0.938	AP-5 complex subunit sigma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051641	0.995	cellular localization
GO:0006810	0.995	transport
GO:0006886	0.988	intracellular protein transport
GO:0006605	0.791	protein targeting
GO:0016192	0.561	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005802	0.995	trans-Golgi network
GO:0070013	0.991	intracellular organelle lumen
GO:0016020	0.988	membrane
GO:0032991	0.970	protein-containing complex
GO:0005829	0.924	cytosol
GO:0031090	0.885	organelle membrane
GO:0031410	0.815	cytoplasmic vesicle
GO:0098796	0.799	membrane protein complex
GO:0005768	0.741	endosome
GO:0030117	0.692	membrane coat
GO:0030119	0.612	AP-type membrane coat adaptor complex
GO:0032588	0.612	trans-Golgi network membrane
GO:0005634	0.505	nucleus
GO:0031981	0.388	nuclear lumen
GO:0031904	0.377	endosome lumen
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]