StarFunc result for job id Q9UPN3

User Input

>input (1400 residues)
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTTHLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYAETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRN
YFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISW
NYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEE
EVEACKARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVVKRIQSLASSRTD
RDAWQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVE
KMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEVVLADLSALEAHWSTL
RHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVI
AQLEIRQSELESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQT
ALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDA
ITQEFMDLRTRYTALVTLTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q503P9	0.228	0.343	5.115E-62	786	0.292	0.520	Q503P9.pdb.gz
2	AFDB:Q13696	0.222	0.800	7.966E-46	385	0.262	0.953	Q13696.pdb.gz	Q13696_HUMAN ACF7 protein (Fragment) OS=Homo sapiens OX=9606 GN=ACF7 PE=4 SV=1
3	AFDB:O15020	0.178	0.116	3.187E-40	2390	0.228	0.133	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:P11277	0.172	0.120	7.058E-40	2137	0.223	0.146	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
5	AFDB:Q01082	0.163	0.106	8.058E-40	2364	0.224	0.132	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
6	AFDB:F1QQE5	0.167	0.107	2.214E-38	2357	0.224	0.133	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
7	AFDB:Q00963	0.160	0.099	4.295E-38	2291	0.221	0.135	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
8	AFDB:E0AHA7	0.166	0.100	7.218E-36	2326	0.201	0.121	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
9	AFDB:Q9H254	0.160	0.097	1.332E-34	2564	0.213	0.116	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
10	AFDB:O60437	0.237	0.191	2.903E-31	1756	0.144	0.114	O60437.pdb.gz	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
11	PDB:4d1eA	0.161	0.250	1.208E-19	859	0.131	0.213	4d1eA.pdb.gz
12	PDB:1sjjA	0.154	0.231	1.131E-15	863	0.130	0.211	1sjjA.pdb.gz
13	PDB:7sx8D	0.129	0.351	1.397E-5	448	0.035	0.109	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7mopA	0.065	0.047	5.199E-3	2445	0.108	0.062	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
15	PDB:7z8fe	0.068	0.034	5.434E-3	4579	0.124	0.038	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
16	PDB:7kzvV	0.069	0.076	1.791E-2	1155	0.099	0.119	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
17	PDB:7r5jC0	0.067	0.051	2.786E-2	2011	0.152	0.106	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:7r5j00	0.064	0.103	3.795E-2	756	0.069	0.128	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7t3uC	0.078	0.071	3.795E-2	1575	0.117	0.104	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:7u9tA	0.066	0.031	4.146E-2	4229	0.087	0.029	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K7P8	637	5394	0.297	0.077	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
2	A0A0B4K7Y9	632	5408	0.297	0.077	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
3	A0A0R4IJ71	1266	4506	0.446	0.138	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
4	A0A286YBE9	1348	4773	0.482	0.141	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
5	A0A2R8PVX9	1290	4580	0.462	0.141	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
6	A0A2R8RIJ1	1289	4599	0.460	0.140	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
7	A1Z9I8	644	5385	0.297	0.077	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A1Z9I9	644	5390	0.297	0.077	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	A1Z9J0	626	5201	0.292	0.079	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	A1Z9J1	627	5501	0.292	0.074	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A5WV02	1296	4577	0.461	0.141	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
12	B7YZG2	644	5370	0.297	0.077	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	B7YZG3	644	5375	0.297	0.077	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	B7YZG4	644	5368	0.297	0.077	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	B7YZG5	626	5486	0.292	0.075	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	B7YZG6	627	5479	0.292	0.075	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	D3ZHV2	2729	5430	0.936	0.241	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
18	E1JH62	644	5388	0.297	0.077	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	E1JH63	626	5499	0.292	0.074	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	E7F8G7	1354	4762	0.481	0.142	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.0011	30.0	CAMSAP CH domain
2	PF00307 CH	5.1e-43	157.1	Calponin homology (CH) domain
3	PF06294 CH_2	26	16.3	CH-like domain in sperm protein
4	PF19831 DUF6312	4.5e+02	12.5	Family of unknown function (DUF6312)
5	PF17902 SH3_10	2.8e-17	73.8	SH3 domain
6	PF00435 Spectrin	0.00019	33.2	Spectrin repeat
7	PF18373 Spectrin_like	2.1e-24	96.8	Spectrin like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349305	0.971	Golgin subfamily A member 4
2	9606.ENSP00000416797	0.955	Calmodulin-regulated spectrin-associated protein 3
3	9606.ENSP00000298854	0.939	43 kDa receptor-associated protein of the synapse
4	9606.ENSP00000364721	0.889	Microtubule-associated protein RP/EB family member 1
5	9606.ENSP00000262320	0.810	Axin-1
6	9606.ENSP00000269571	0.788	Receptor tyrosine-protein kinase erbB-2
7	9606.ENSP00000355593	0.769	Disrupted in schizophrenia 1 protein
8	9606.ENSP00000261778	0.763	Transport and golgi organization 6 homolog
9	9606.ENSP00000417518	0.727	CLIP-associating protein 2
10	9606.ENSP00000334308	0.722	Nesprin-3
11	9606.ENSP00000312185	0.710	Engulfment and cell motility protein 1
12	9606.ENSP00000236925	0.667	Calmodulin-regulated spectrin-associated protein 2
13	9606.ENSP00000479322	0.656	CAP-Gly domain-containing linker protein 1
14	9606.ENSP00000263710	0.645	CLIP-associating protein 1
15	9606.ENSP00000233121	0.644	Microtubule-associated protein RP/EB family member 3
16	9606.ENSP00000374183	0.632	Calmodulin-regulated spectrin-associated protein 1
17	9606.ENSP00000261263	0.612	Ras-related protein Rab-21
18	9606.ENSP00000353608	0.610	Desmocollin-3
19	9606.ENSP00000432768	0.604	Cytoskeleton-associated protein 5
20	9606.ENSP00000221455	0.600	CLK4-associating serine/arginine rich protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0003779	0.955	actin binding
GO:0044877	0.354	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.735	biological regulation
GO:0050794	0.725	regulation of cellular process
GO:0030111	0.721	regulation of Wnt signaling pathway
GO:0009987	0.589	cellular process
GO:0023056	0.556	positive regulation of signaling
GO:0010647	0.556	positive regulation of cell communication
GO:0048584	0.552	positive regulation of response to stimulus
GO:0009967	0.507	positive regulation of signal transduction
GO:0032502	0.323	developmental process
GO:0032501	0.320	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0043229	0.994	intracellular organelle
GO:0005737	0.993	cytoplasm
GO:0043232	0.956	intracellular non-membrane-bounded organelle
GO:0016020	0.939	membrane
GO:0071944	0.922	cell periphery
GO:0005856	0.603	cytoskeleton
GO:0099080	0.582	supramolecular complex
GO:0099081	0.566	supramolecular polymer
GO:0099512	0.524	supramolecular fiber
GO:0005886	0.519	plasma membrane
GO:0030054	0.501	cell junction
GO:0043231	0.353	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]